You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11574
Secondary Accession Numbers
  • 21018
Name N-acetyltransferase ESCO1
Synonyms
  1. CTF7 homolog 1
  2. ECO1 homolog 1
  3. EFO1p
  4. ESO1 homolog 1
  5. Establishment factor-like protein 1
  6. Establishment of cohesion 1 homolog 1
  7. hEFO1
Gene Name ESCO1
Protein Type Enzyme
Biological Properties
General Function Involved in damaged DNA binding
Specific Function Acetyltransferase required for the establishment of sister chromatid cohesion and couple the processes of cohesion and DNA replication to ensure that only sister chromatids become paired together. In contrast to the structural cohesins, the deposition and establishment factors are required only during S phase. Acts by mediating the acetylation of cohesin component SMC3
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
dna polymerase activity
dna-directed dna polymerase activity
damaged dna binding
nucleic acid binding
dna binding
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
dna metabolic process
dna repair
Cellular Location
  1. Nucleus
  2. Chromosome
Gene Properties
Chromosome Location Chromosome:1
Locus 18q11.2
SNPs ESCO1
Gene Sequence
>2523 bp
ATGATGTCCATTCAGGAGAAATCAAAAGAGAATTCCTCCAAAGTTACTAAAAAAAGTGAC
GATAAGAATTCAGAAACAGAAATTCAGGATTCTCAAAAGAATCTAGCAAAAAAATCAGGT
CCAAAGGAGACTATAAAATCACAGGCTAAATCTTCCAGTGAAAGTAAAATAAATCAGCCA
GAATTGGAAACACGCATGAGTACAAGGTCATCAAAGGCAGCATCTAATGATAAAGCTACT
AAATCCATTAATAAAAATACGGTGACTGTGAGGGGATATTCACAAGAATCTACAAAAAAG
AAATTATCTCAGAAAAAATTAGTACATGAAAACCCTAAAGCAAATGAACAGCTTAACCGG
AGATCACAAAGGCTACAACAATTAACAGAGGTTTCAAGAAGGTCGTTACGCAGTAGAGAA
ATTCAGGGTCAAGTTCAAGCAGTTAAACAGAGTTTGCCACCAACTAAAAAAGAGCAGTGT
AGCAGTACTCAGAGTAAATCTAATAAAACAAGTCAAAAACATGTGAAGAGAAAAGTACTG
GAAGTAAAGTCTGACTCTAAAGAAGATGAAAATCTAGTAATTAATGAAGTAATAAATTCT
CCCAAAGGGAAAAAACGCAAGGTAGAACATCAGACAGCTTGTGCTTGTAGTTCTCAATGC
ACGCAAGGATCTGAAAAGTGTCCTCAGAAGACTACTAGAAGAGACGAAACGAAACCTGTG
CCTGTAACTTCTGAGGTGAAAAGATCAAAAATGGCTACTTCAGTGGTCCCGAAAAAGAAT
GAGATGAAGAAGTCGGTTCATACACAAGTGAATACTAACACAACACTCCCAAAAAGTCCA
CAGCCATCAGTGCCTGAACAAAGTGATAATGAGCTGGAGCAAGCAGGAAAGAGCAAACGA
GGTAGTATTCTCCAGCTCTGTGAAGAAATTGCTGGTGAAATTGAGTCAGATAATGTAGAG
GTAAAAAAGGAATCTTCACAAATGGAAAGTGTAAAGGAAGAAAAGCCCACAGAAATAAAA
TTGGAAGAGACCAGTGTTGAAAGACAAATACTTCATCAGAAGGAAACAAATCAGGATGTG
CAATGTAATCGTTTTTTCCCAAGTAGAAAAACAAAGCCTGTGAAATGTATACTAAATGGA
ATAAACAGCTCAGCCAAGAAGAACTCCAACTGGACTAAAATTAAACTCTCAAAATTTAAC
TCTGTGCAGCACAATAAGTTGGACTCTCAAGTTTCCCCTAAATTAGGCTTATTACGAACC
AGTTTTTCACCACCAGCTTTAGAAATGCATCATCCAGTGACTCAAAGTACGTTTTTAGGG
ACAAAGCTACATGATAGAAATATAACTTGCCAGCAGGAAAAAATGAAAGAAATTAATTCT
GAAGAAGTGAAAATTAATGATATTACAGTAGAAATTAATAAAACCACAGAAAGGGCTCCT
GAAAATTGTCATTTGGCCAATGAGATAAAACCTTCTGACCCACCATTGGATAATCAGATG
AAACATTCTTTTGATTCAGCATCAAATAAGAATTTCAGCCAATGTTTGGAATCCAAGCTA
GAAAACAGTCCAGTGGAAAATGTTACTGCTGCTTCGACTCTGCTCAGTCAAGCAAAAATT
GATACAGGAGAGAATAAATTTCCAGGTTCAGCTCCCCAACAGCATAGTATTCTCAGTAAC
CAGACATCTAAAAGCAGTGATAACAGGGAGACACCACGAAATCATTCTTTGCCTAAGTGT
AATTCCCATTTGGAGATAACAATTCCAAAGGACTTGAAACTAAAAGAAGCAGAGAAAACT
GATGAAAAACAGTTGATTATAGATGCAGGACAAAAAAGATTTGGAGCAGTTTCTTGTAAT
GTTTGTGGAATGCTGTATACAGCTTCAAATCCAGAAGATGAAACACAGCATCTGCTTTTC
CACAACCAGTTTATAAGTGCTGTTAAATATGTGGGCTGGAAGAAAGAAAGAATTCTGGCT
GAATACCCTGATGGCAGGATAATAATGGTTCTTCCTGAAGACCCAAAGTATGCCCTGAAA
AAGGTTGACGAGATTAGAGAGATGGTTGACAATGATTTAGGTTTTCAACAGGCTCCACTA
ATGTGCTATTCCAGAACTAAAACACTTCTCTTCATTTCCAATGACAAAAAAGTAGTTGGC
TGCCTAATTGCGGAACATATCCAATGGGGCTACAGAGTTATAGAAGAGAAACTTCCAGTT
ATCAGGTCAGAAGAAGAAAAAGTCAGATTTGAAAGGCAAAAAGCCTGGTGCTGCTCAACA
TTACCAGAGCCTGCAATCTGCGGGATCAGTCGAATATGGGTATTCAGCATGATGCGTCGG
AAGAAAATTGCTTCTCGCATGATTGAATGCCTAAGGAGTAACTTTATATATGGCTCATAT
TTGAGCAAAGAAGAAATTGCTTTCTCAGATCCCACTCCTGATGGAAAGCTGTTTGCAACA
CAGTACTGTGGCACTGGTCAATTTCTGGTATATAATTTTATTAATGGACAGAATAGCACG
TAA
Protein Properties
Number of Residues 840
Molecular Weight 94982.2
Theoretical pI 9.73
Pfam Domain Function Not Available
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>N-acetyltransferase ESCO1
MMSIQEKSKENSSKVTKKSDDKNSETEIQDSQKNLAKKSGPKETIKSQAKSSSESKINQP
ELETRMSTRSSKAASNDKATKSINKNTVTVRGYSQESTKKKLSQKKLVHENPKANEQLNR
RSQRLQQLTEVSRRSLRSREIQGQVQAVKQSLPPTKKEQCSSTQSKSNKTSQKHVKRKVL
EVKSDSKEDENLVINEVINSPKGKKRKVEHQTACACSSQCTQGSEKCPQKTTRRDETKPV
PVTSEVKRSKMATSVVPKKNEMKKSVHTQVNTNTTLPKSPQPSVPEQSDNELEQAGKSKR
GSILQLCEEIAGEIESDNVEVKKESSQMESVKEEKPTEIKLEETSVERQILHQKETNQDV
QCNRFFPSRKTKPVKCILNGINSSAKKNSNWTKIKLSKFNSVQHNKLDSQVSPKLGLLRT
SFSPPALEMHHPVTQSTFLGTKLHDRNITCQQEKMKEINSEEVKINDITVEINKTTERAP
ENCHLANEIKPSDPPLDNQMKHSFDSASNKNFSQCLESKLENSPVENVTAASTLLSQAKI
DTGENKFPGSAPQQHSILSNQTSKSSDNRETPRNHSLPKCNSHLEITIPKDLKLKEAEKT
DEKQLIIDAGQKRFGAVSCNVCGMLYTASNPEDETQHLLFHNQFISAVKYVGWKKERILA
EYPDGRIIMVLPEDPKYALKKVDEIREMVDNDLGFQQAPLMCYSRTKTLLFISNDKKVVG
CLIAEHIQWGYRVIEEKLPVIRSEEEKVRFERQKAWCCSTLPEPAICGISRIWVFSMMRR
KKIASRMIECLRSNFIYGSYLSKEEIAFSDPTPDGKLFATQYCGTGQFLVYNFINGQNST
GenBank ID Protein 116235478
UniProtKB/Swiss-Prot ID Q5FWF5
UniProtKB/Swiss-Prot Entry Name ESCO1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_052911.2
GeneCard ID ESCO1
GenAtlas ID ESCO1
HGNC ID HGNC:24645
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005 ]
  6. Nagase T, Kikuno R, Ohara O: Prediction of the coding sequences of unidentified human genes. XXI. The complete sequences of 60 new cDNA clones from brain which code for large proteins. DNA Res. 2001 Aug 31;8(4):179-87. [PubMed:11572484 ]
  7. Bellows AM, Kenna MA, Cassimeris L, Skibbens RV: Human EFO1p exhibits acetyltransferase activity and is a unique combination of linker histone and Ctf7p/Eco1p chromatid cohesion establishment domains. Nucleic Acids Res. 2003 Nov 1;31(21):6334-43. [PubMed:14576321 ]
  8. Hou F, Zou H: Two human orthologues of Eco1/Ctf7 acetyltransferases are both required for proper sister-chromatid cohesion. Mol Biol Cell. 2005 Aug;16(8):3908-18. Epub 2005 Jun 15. [PubMed:15958495 ]
  9. Zhang J, Shi X, Li Y, Kim BJ, Jia J, Huang Z, Yang T, Fu X, Jung SY, Wang Y, Zhang P, Kim ST, Pan X, Qin J: Acetylation of Smc3 by Eco1 is required for S phase sister chromatid cohesion in both human and yeast. Mol Cell. 2008 Jul 11;31(1):143-51. doi: 10.1016/j.molcel.2008.06.006. [PubMed:18614053 ]