You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11579
Secondary Accession Numbers
  • 21023
Name Ribosomal protein S6 kinase beta-2
Synonyms
  1. 70 kDa ribosomal protein S6 kinase 2
  2. P70S6K2
  3. S6 kinase-related kinase
  4. S6K-beta
  5. S6K-beta-2
  6. S6K2
  7. SRK
  8. Serine/threonine-protein kinase 14B
  9. p70 S6 kinase beta
  10. p70 S6K-beta
  11. p70 S6KB
  12. p70 ribosomal S6 kinase beta
  13. p70-S6K 2
  14. p70-beta
Gene Name RPS6KB2
Protein Type Enzyme
Biological Properties
General Function Involved in protein serine/threonine kinase activity
Specific Function Phosphorylates specifically ribosomal protein S6
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
kinase activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
atp binding
protein kinase activity
protein serine/threonine kinase activity
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
biological regulation
regulation of biological process
cellular metabolic process
regulation of cellular process
signal transduction
protein amino acid phosphorylation
phosphorylation
Cellular Location Not Available
Gene Properties
Chromosome Location Chromosome:1
Locus 11q13.2
SNPs RPS6KB2
Gene Sequence
>1449 bp
ATGGCGGCCGTGTTTGATTTGGATTTGGAGACGGAGGAAGGCAGCGAGGGCGAGGGCGAG
CCAGAGCTCAGCCCCGCGGACGCATGTCCCCTTGCCGAGTTGAGGGCAGCTGGCCTAGAG
CCTGTGGGACACTATGAAGAGGTGGAGCTGACTGAGACCAGCGTGAACGTTGGCCCAGAG
CGCATCGGGCCCCACTGCTTTGAGCTGCTGCGTGTGCTGGGCAAGGGGGGCTATGGCAAG
GTGTTCCAGGTGCGAAAGGTGCAAGGCACCAACTTGGGCAAAATATATGCCATGAAAGTC
CTAAGGAAGGCCAAAATTGTGCGCAATGCCAAGGACACAGCACACACACGGGCTGAGCGG
AACATTCTAGAGTCAGTGAAGCACCCCTTTATTGTGGAACTGGCCTATGCCTTCCAGACT
GGTGGCAAACTCTACCTCATCCTTGAGTGCCTCAGTGGTGGCGAGCTCTTCACGCATCTG
GAGCGAGAGGGCATCTTCCTGGAAGATACGGCCTGCTTCTACCTGGCTGAGATCACGCTG
GCCCTGGGCCATCTCCACTCCCAGGGCATCATCTACCGGGACCTCAAGCCCGAGAACATC
ATGCTCAGCAGCCAGGGCCACATCAAACTGACCGACTTTGGACTCTGCAAGGAGTCTATC
CATGAGGGCGCCGTCACTCACACCTTCTGCGGCACCATTGAGTACATGGCCCCTGAGATT
CTGGTGCGCAGTGGCCACAACCGGGCTGTGGACTGGTGGAGCCTGGGGGCCCTGATGTAC
GACATGCTCACTGGATCGCCGCCCTTCACCGCAGAGAACCGGAAGAAAACCATGGATAAG
ATCATCAGGGGCAAGCTGGCACTGCCCCCCTACCTCACCCCAGATGCCCGGGACCTTGTC
AAAAAGTTTCTGAAACGGAATCCCAGCCAGCGGATTGGGGGTGGCCCAGGGGATGCTGCT
GATGTGCAGAGACATCCCTTTTTCCGGCACATGAATTGGGACGACCTTCTGGCCTGGCGT
GTGGACCCCCCTTTCAGGCCCTGTCTGCAGTCAGAGGAGGACGTGAGCCAGTTTGATACC
CGCTTCACACGGCAGACGCCGGTGGACAGTCCTGATGACACAGCCCTCAGCGAGAGTGCC
AACCAGGCCTTCCTGGGCTTCACATACGTGGCGCCGTCTGTCCTGGACAGCATCAAGGAG
GGCTTCTCCTTCCAGCCCAAGCTGCGCTCACCCAGGCGCCTCAACAGTAGCCCCCGGGCC
CCCGTCAGCCCCCTCAAGTTCTCCCCTTTTGAGGGGTTTCGGCCCAGCCCCAGCCTGCCG
GAGCCCACGGAGCTACCTCTACCTCCACTCCTGCCACCGCCGCCGCCCTCGACCACCGCC
CCTCTCCCCATCCGTCCCCCCTCAGGGACCAAGAAGTCCAAGAGGGGCCGTGGGCGTCCA
GGGCGCTAG
Protein Properties
Number of Residues 482
Molecular Weight 53454.7
Theoretical pI 7.37
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ribosomal protein S6 kinase beta-2
MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPE
RIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAER
NILESVKHPFIVELAYAFQTGGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITL
ALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGLCKESIHEGAVTHTFCGTIEYMAPEI
LVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDKIIRGKLALPPYLTPDARDLV
KKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQSEEDVSQFDT
RFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRA
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRP
GR
GenBank ID Protein 55953117
UniProtKB/Swiss-Prot ID Q9UBS0
UniProtKB/Swiss-Prot Entry Name KS6B2_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_003952.2
GeneCard ID RPS6KB2
GenAtlas ID RPS6KB2
HGNC ID HGNC:10437
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  3. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  4. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811 ]
  5. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [PubMed:17344846 ]
  6. Gout I, Minami T, Hara K, Tsujishita Y, Filonenko V, Waterfield MD, Yonezawa K: Molecular cloning and characterization of a novel p70 S6 kinase, p70 S6 kinase beta containing a proline-rich region. J Biol Chem. 1998 Nov 13;273(46):30061-4. [PubMed:9804755 ]
  7. Saitoh M, ten Dijke P, Miyazono K, Ichijo H: Cloning and characterization of p70(S6K beta) defines a novel family of p70 S6 kinases. Biochem Biophys Res Commun. 1998 Dec 18;253(2):470-6. [PubMed:9878560 ]
  8. Lee-Fruman KK, Kuo CJ, Lippincott J, Terada N, Blenis J: Characterization of S6K2, a novel kinase homologous to S6K1. Oncogene. 1999 Sep 9;18(36):5108-14. [PubMed:10490847 ]