Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11580
Secondary Accession Numbers
  • 21024
Name Histone acetyltransferase KAT7
Synonyms
  1. Histone acetyltransferase binding to ORC1
  2. MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2
  3. MYST-2
  4. Lysine acetyltransferase 7
Gene Name KAT7
Protein Type Enzyme
Biological Properties
General Function Involved in transferase activity, transferring acyl groups other than amino-acyl groups
Specific Function Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Specifically represses AR-mediated transcription.
Pathways Not Available
Reactions
Acetyl-CoA + [histone] → Coenzyme A + acetyl-[histone] details
GO Classification
Biological Process
DNA replication
histone H3 acetylation
regulation of transcription, DNA-dependent
transcription, DNA-dependent
histone H4-K12 acetylation
histone H4-K5 acetylation
histone H4-K8 acetylation
Cellular Component
histone acetyltransferase complex
Component
cell part
organelle
membrane-bounded organelle
intracellular membrane-bounded organelle
nucleus
intracellular
Function
ion binding
cation binding
metal ion binding
binding
catalytic activity
transition metal ion binding
zinc ion binding
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
sequence-specific dna binding transcription factor activity
Molecular Function
metal ion binding
sequence-specific DNA binding transcription factor activity
zinc ion binding
histone acetyltransferase activity
Process
biological regulation
regulation of biological process
regulation of metabolic process
regulation of macromolecule metabolic process
regulation of gene expression
regulation of transcription
regulation of transcription, dna-dependent
Cellular Location
  1. Nucleus
  2. nucleoplasm
Gene Properties
Chromosome Location 17
Locus 17q21.32
SNPs MYST2
Gene Sequence
>1836 bp
ATGCCGCGAAGGAAGAGGAATGCAGGCAGTAGTTCAGATGGAACCGAAGATTCCGATTTT
TCTACAGATCTCGAGCACACAGACAGTTCAGAAAGTGATGGCACATCCCGACGATCTGCT
CGAGTCACCCGCTCCTCAGCCAGGCTAAGCCAGAGTTCTCAAGATTCCAGTCCTGTTCGA
AATCTGCAGTCTTTTGGCACTGAGGAGCCTGCTTACTCTACCAGAAGAGTGACCCGTAGT
CAGCAGCAGCCTACCCCAGTGACACCGAAAAAATACCCTCTTCGGCAGACTCGTTCATCT
GGTTCAGAAACTGAGCAAGTGGTTGATTTTTCAGATAGAGAAACTAAAAATACAGCTGAT
CATGATGAGTCACCGCCTCGAACTCCAACTGGAAATGCGCCTTCTTCTGAGTCTGACATA
GATATCTCCAGCCCCAATGTATCTCACGATGAGAGCATTGCCAAGGACATGTCCCTGAAG
GACTCAGGCAGTGATCTCTCTCATCGCCCCAAGCGCCGTCGCTTCCATGAAAGCTACAAC
TTCAATATGAAGTGTCCTACACCAGGCTGTAACTCTCTAGGACACCTTACAGGAAAACAT
GAGAGACATTTCTCCATCTCAGGATGCCCACTGTATCATAACCTCTCAGCTGACGAATGC
AAGGTGAGAGCACAGAGCCGGGATAAGCAGATAGAAGAAAGGATGCTGTCTCACAGGCAA
GATGACAACAACAGGCATGCAACCAGGCACCAGGCACCAACGGAGAGGCAGCTTCGATAT
AAGGAAAAAGTGGCTGAACTCAGGAAGAAAAGAAATTCTGGACTGAGCAAAGAACAGAAA
GAGAAATATATGGAACACAGACAGACCTATGGGAACACACGGGAACCTCTTTTAGAAAAC
CTGACAAGCGAGTATGACTTGGATCTTTTCCGAAGAGCACAAGCCCGGGCTTCAGAGGAT
TTGGAGAAGTTAAGGCTGCAAGGCCAAATCACAGAGGGAAGCAACATGATTAAAACAATT
GCTTTTGGCCGCTATGAGCTTGATACCTGGTATCATTCTCCATATCCTGAAGAATATGCA
CGGCTGGGACGTCTCTATATGTGTGAATTCTGTTTAAAATATATGAAGAGCCAAACGATA
CTCCGCCGGCACATGGCCAAATGTGTGTGGAAACACCCACCTGGTGATGAGATATATCGC
AAAGGTTCAATCTCTGTGTTTGAAGTGGATGGCAAGAAAAACAAGATCTACTGCCAAAAC
CTGTGCCTGTTGGCCAAACTTTTTCTGGACCACAAGACATTATATTATGATGTGGAGCCC
TTCCTGTTCTATGTTATGACAGAGGCGGACAACACTGGCTGTCACCTGATTGGATATTTT
TCTAAGGAAAAGAATTCATTCCTCAACTACAACGTCTCCTGTATCCTTACTATGCCTCAG
TACATGAGACAGGGCTATGGCAAGATGCTTATTGATTTCAGTTATTTGCTTTCCAAAGTC
GAAGAAAAAGTTGGCTCCCCAGAACGTCCACTCTCAGATCTGGGGCTTATAAGCTATCGC
AGTTACTGGAAAGAAGTACTTCTCCGCTACCTGCATAATTTTCAAGGCAAAGAGATTTCT
ATCAAAGAAATCAGTCAGGAGACGGCTGTGAATCCTGTGGACATTGTCAGCACTCTGCAA
GCCCTTCAGATGCTCAAATACTGGAAGGGAAAACACCTAGTTTTAAAGAGACAGGACCTG
ATTGATGAGTGGATAGCCAAAGAGGCCAAAAGGTCCAACTCCAATAAAACCATGGATCCC
AGCTGCTTAAAATGGACCCCTCCCAAGGGCACTTAA
Protein Properties
Number of Residues 611
Molecular Weight 66946.78
Theoretical pI 8.724
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Histone acetyltransferase MYST2
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
GenBank ID Protein 4091980
UniProtKB/Swiss-Prot ID O95251
UniProtKB/Swiss-Prot Entry Name MYST2_HUMAN
PDB IDs Not Available
GenBank Gene ID AF074606
GeneCard ID MYST2
GenAtlas ID MYST2
HGNC ID HGNC:17016
References
General References
  1. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M: Lysine acetylation targets protein complexes and co-regulates major cellular functions. Science. 2009 Aug 14;325(5942):834-40. doi: 10.1126/science.1175371. Epub 2009 Jul 16. [PubMed:19608861 ]
  4. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  5. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  6. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  7. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [PubMed:19413330 ]
  8. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  9. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243 ]
  10. Doyon Y, Cayrou C, Ullah M, Landry AJ, Cote V, Selleck W, Lane WS, Tan S, Yang XJ, Cote J: ING tumor suppressor proteins are critical regulators of chromatin acetylation required for genome expression and perpetuation. Mol Cell. 2006 Jan 6;21(1):51-64. [PubMed:16387653 ]
  11. Wang B, Malik R, Nigg EA, Korner R: Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis. Anal Chem. 2008 Dec 15;80(24):9526-33. doi: 10.1021/ac801708p. [PubMed:19007248 ]
  12. Sharma M, Zarnegar M, Li X, Lim B, Sun Z: Androgen receptor interacts with a novel MYST protein, HBO1. J Biol Chem. 2000 Nov 10;275(45):35200-8. [PubMed:10930412 ]
  13. Iizuka M, Stillman B: Histone acetyltransferase HBO1 interacts with the ORC1 subunit of the human initiator protein. J Biol Chem. 1999 Aug 13;274(33):23027-34. [PubMed:10438470 ]
  14. Burke TW, Cook JG, Asano M, Nevins JR: Replication factors MCM2 and ORC1 interact with the histone acetyltransferase HBO1. J Biol Chem. 2001 May 4;276(18):15397-408. Epub 2001 Jan 24. [PubMed:11278932 ]