You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11586
Secondary Accession Numbers
  • 21030
Name Ubiquitin carboxyl-terminal hydrolase 20
Synonyms
  1. Deubiquitinating enzyme 20
  2. Ubiquitin thiolesterase 20
  3. Ubiquitin-specific-processing protease 20
  4. VHL-interacting deubiquitinating enzyme 2
  5. hVDU2
Gene Name USP20
Protein Type Enzyme
Biological Properties
General Function Involved in ubiquitin thiolesterase activity
Specific Function Deubiquitinating enzyme involved in beta-2 adrenergic receptor (ADRB2) recycling. Acts as a regulator of G-protein coupled receptor (GPCR) signaling by mediating the deubiquitination beta-2 adrenergic receptor (ADRB2). Plays a central role in ADRB2 recycling and resensitization after prolonged agonist stimulation by constitutively binding ADRB2, mediating deubiquitination of ADRB2 and inhibiting lysosomal trafficking of ADRB2. Upon dissociation, it is probably transferred to the translocated beta-arrestins, possibly leading to beta-arrestins deubiquitination and disengagement from ADRB2. This suggests the existence of a dynamic exchange between the ADRB2 and beta-arrestins. Deubiquitinates DIO2, thereby regulating thyroid hormone regulation. Deubiquitinates HIF1A, leading to stabilize HIF1A and enhance HIF1A-mediated activity. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains
Pathways Not Available
Reactions Not Available
GO Classification
Function
ion binding
cation binding
metal ion binding
hydrolase activity, acting on ester bonds
binding
catalytic activity
hydrolase activity
transition metal ion binding
zinc ion binding
ubiquitin thiolesterase activity
thiolester hydrolase activity
Process
metabolic process
catabolic process
macromolecule catabolic process
cellular macromolecule catabolic process
modification-dependent macromolecule catabolic process
modification-dependent protein catabolic process
ubiquitin-dependent protein catabolic process
Cellular Location
  1. Cytoplasm
  2. perinuclear region
Gene Properties
Chromosome Location Chromosome:9
Locus 9q34.11
SNPs USP20
Gene Sequence
>2745 bp
ATGGGGGACTCCAGGGACCTTTGCCCTCACCTTGACTCCATAGGAGAGGTGACCAAAGAG
GACTTGCTGCTCAAATCTAAGGGAACCTGTCAGTCGTGTGGGGTCACCGGACCAAACCTA
TGGGCCTGTCTGCAGGTTGCCTGCCCCTATGTTGGCTGCGGAGAATCCTTTGCTGACCAC
AGCACCATTCATGCACAGGCAAAAAAGCACAACTTGACCGTGAACCTGACCACGTTCCGA
CTGTGGTGTTACGCCTGTGAGAAGGAGGTATTCCTGGAGCAGCGGCTGGCAGCCCCTCTG
CTGGGCTCCTCTTCCAAGTTCTCTGAACAGGACTCCCCGCCACCCTCCCACCCTCTGAAA
GCTGTTCCTATTGCTGTGGCTGATGAAGGAGAGTCTGAGTCAGAGGACGATGACCTGAAA
CCTCGAGGCCTCACGGGCATGAAGAACCTCGGGAACTCCTGCTACATGAACGCTGCCCTG
CAGGCCCTGTCCAATTGCCCGCCGCTGACTCAGTTCTTCTTGGAGTGTGGCGGCCTGGTG
CGCACAGATAAGAAGCCAGCCCTGTGCAAGAGCTACCAGAAGCTGGTCTCTGAGGTCTGG
CATAAGAAACGGCCAAGCTACGTGGTCCCCACCAGTCTGTCTCATGGGATCAAGTTGGTC
AACCCAATGTTCCGAGGCTATGCCCAGCAGGACACCCAAGAGTTCCTTCGCTGCCTGATG
GACCAGCTGCACGAGGAGCTCAAGGAGCCGGTGGTGGCCACGGTGGCGCTGACGGAGGCT
CGGGACTCAGATTCGAGTGACACGGATGAGAAACGGGAGGGTGACCGGAGCCCATCAGAA
GATGAGTTCTTGTCCTGTGACTCGAGCAGTGACCGGGGTGAGGGTGACGGGCAGGGGCGT
GGCGGGGGCAGCTCGCAGGCCGAGACGGAGCTGCTGATCCCAGATGAGGCGGGCCGAGCC
ATCTCTGAGAAGGAGCGGATGAAGGACCGCAAGTTCTCCTGGGGCCAGCAGCGTACAAAC
TCGGAGCAAGTGGACGAGGACGCTGATGTGGACACTGCCATGGCTGCCCTTGACGACCAG
CCCGCGGAGGCCCAGCCCCCGTCACCACGGTCCTCCAGCCCCTGCCGGACGCCAGAGCCG
GACAATGATGCTCACCTACGCAGCTCCTCTCGCCCCTGCAGCCCCGTCCACCACCACGAG
GGCCATGCCAAGCTGTCTAGCAGCCCCCCTCGTGCAAGCCCCGTGAGGATGGCACCGTCG
TACGTGCTCAAGAAAGCCCAGGTATTGAGTGCTGGCAGCCGGAGGCGGAAGGAGCAGCGC
TACCGCAGCGTCATCTCAGACATCTTTGACGGCTCCATTCTCAGCCTTGTGCAGTGTCTC
ACCTGTGACCGGGTATCCACCACAGTGGAAACGTTCCAGGACTTATCACTGCCCATTCCT
GGAAAGGAGGACCTGGCCAAGCTCCATTCAGCCATCTACCAGAATGTGCCGGCCAAGCCA
GGCGCCTGTGGGGACAGCTATGCCGCCCAGGGCTGGCTGGCCTTCATTGTGGAGTACATC
CGACGGTTTGTGGTATCCTGTACCCCCAGCTGGTTTTGGGGGCCTGTCGTCACCCTGGAA
GACTGCCTTGCTGCCTTCTTTGCCGCTGATGAGTTAAAGGGTGACAACATGTACAGCTGT
GAGCGGTGTAAGAAGCTGCGGAACGGAGTGAAGTACTGCAAAGTCCTGCGGTTGCCCGAG
ATCCTGTGCATTCACCTAAAGCGCTTTCGGCACGAGGTGATGTACTCATTCAAGATCAAC
AGCCACGTCTCCTTCCCCCTCGAGGGGCTCGACCTGCGCCCCTTCCTTGCCAAGGAGTGC
ACATCCCAGATCACCACCTACGACCTCCTCTCGGTCATCTGCCACCACGGCACGGCAGGC
AGTGGGCACTACATCGCCTACTGCCAGAACGTGATCAATGGGCAGTGGTACGAGTTTGAT
GACCAGTACGTCACAGAAGTCCACGAGACGGTGGTGCAGAACGCCGAGGGCTACGTACTC
TTCTACAGGAAGAGCAGCGAGGAGGCCATGCGGGAGCGACAGCAGGTGGTGTCCCTGGCC
GCCATGCGGGAGCCCAGCCTGCTGCGGTTCTACGTGTCCCGCGAGTGGCTCAACAAGTTC
AACACCTTCGCGGAGCCAGGCCCCATCACCAACCAGACCTTCCTCTGCTCCCACGGAGGC
ATCCCGCCCCACAAATACCACTACATCGACGACCTGGTGGTCATCCTGCCCCAGAACGTC
TGGGAGCACCTGTACAACAGATTCGGGGGTGGCCCCGCCGTGAACCACCTGTACGTGTGC
TCCATCTGCCAGGTGGAGATCGAGGCACTGGCCAAGCGCAGGAGGATCGAGATCGACACC
TTCATCAAGTTGAACAAGGCCTTCCAGGCCGAGGAGTCGCCGGGCGTCATCTACTGCATC
AGCATGCAGTGGTTCCGGGAGTGGGAGGCGTTCGTCAAGGGGAAGGACAACGAGCCCCCC
GGGCCCATTGACAACAGCAGGATTGCACAGGTCAAAGGAAGCGGCCATGTCCAGCTGAAG
CAGGGAGCTGACTACGGGCAGATTTCGGAGGAGACCTGGACCTACCTGAACAGCCTGTAT
GGAGGTGGCCCCGAGATTGCCATCCGCCAGAGTGTGGCGCAGCCGCTGGGCCCAGAGAAC
CTGCACGGGGAGCAGAAGATCGAAGCCGAGACGCGGGCCGTGTGA
Protein Properties
Number of Residues 914
Molecular Weight 102002.2
Theoretical pI 6.03
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>Ubiquitin carboxyl-terminal hydrolase 20
MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADH
STIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGR
GGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDADVDTAMAALDDQ
PAEAQPPSPRSSSPCRTPEPDNDAHLRSSSRPCSPVHHHEGHAKLSSSPPRASPVRMAPS
YVLKKAQVLSAGSRRRKEQRYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPIP
GKEDLAKLHSAIYQNVPAKPGACGDSYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLE
DCLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKIN
SHVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFD
DQYVTEVHETVVQNAEGYVLFYRKSSEEAMRERQQVVSLAAMREPSLLRFYVSREWLNKF
NTFAEPGPITNQTFLCSHGGIPPHKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVC
SICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPGVIYCISMQWFREWEAFVKGKDNEPP
GPIDNSRIAQVKGSGHVQLKQGADYGQISEETWTYLNSLYGGGPEIAIRQSVAQPLGPEN
LHGEQKIEAETRAV
GenBank ID Protein 183397136
UniProtKB/Swiss-Prot ID Q9Y2K6
UniProtKB/Swiss-Prot Entry Name UBP20_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_001008563.3
GeneCard ID USP20
GenAtlas ID USP20
HGNC ID HGNC:12619
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648 ]
  3. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [PubMed:19690332 ]
  4. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [PubMed:18691976 ]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983 ]
  6. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053 ]
  7. Nagase T, Ishikawa K, Suyama M, Kikuno R, Hirosawa M, Miyajima N, Tanaka A, Kotani H, Nomura N, Ohara O: Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro. DNA Res. 1999 Feb 26;6(1):63-70. [PubMed:10231032 ]
  8. Gilley J, Fried M: Extensive gene order differences within regions of conserved synteny between the Fugu and human genomes: implications for chromosomal evolution and the cloning of disease genes. Hum Mol Genet. 1999 Jul;8(7):1313-20. [PubMed:10369878 ]
  9. Curcio-Morelli C, Zavacki AM, Christofollete M, Gereben B, de Freitas BC, Harney JW, Li Z, Wu G, Bianco AC: Deubiquitination of type 2 iodothyronine deiodinase by von Hippel-Lindau protein-interacting deubiquitinating enzymes regulates thyroid hormone activation. J Clin Invest. 2003 Jul;112(2):189-96. [PubMed:12865408 ]
  10. Berthouze M, Venkataramanan V, Li Y, Shenoy SK: The deubiquitinases USP33 and USP20 coordinate beta2 adrenergic receptor recycling and resensitization. EMBO J. 2009 Jun 17;28(12):1684-96. doi: 10.1038/emboj.2009.128. Epub 2009 May 7. [PubMed:19424180 ]
  11. Li Z, Wang D, Messing EM, Wu G: VHL protein-interacting deubiquitinating enzyme 2 deubiquitinates and stabilizes HIF-1alpha. EMBO Rep. 2005 Apr;6(4):373-8. [PubMed:15776016 ]
  12. Li Z, Wang D, Na X, Schoen SR, Messing EM, Wu G: Identification of a deubiquitinating enzyme subfamily as substrates of the von Hippel-Lindau tumor suppressor. Biochem Biophys Res Commun. 2002 Jun 14;294(3):700-9. [PubMed:12056827 ]