Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11592
Secondary Accession Numbers None
Name Probable DNA dC->dU-editing enzyme APOBEC-3B
Synonyms
  1. Phorbolin-1-related protein
  2. Phorbolin-2/3
Gene Name APOBEC3B
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable DNA cytidine deaminase involved in foreign DNA clearance. May provide cellular innate resistance to a specific panel of genetic invaders including endogenous retroelements and a subset of viruses. Binds to apoB and AU-rich RNAs.
Pathways Not Available
Reactions
Cytidine + Water → Uridine + Ammonia details
GO Classification
Biological Process
negative regulation of transposition
metabolic process
Molecular Function
metal ion binding
zinc ion binding
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.1-q13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 43107.7
Theoretical pI 5.913
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|393715119|ref|NP_001257340.1| DNA dC->dU-editing enzyme APOBEC-3B isoform b [Homo sapiens]
MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVY
FKPQYHAEMC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UH17
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17352
References
General References Not Available