You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11593
Secondary Accession Numbers None
Name Probable DNA dC->dU-editing enzyme APOBEC-3C
Synonyms
  1. APOBEC1-like
  2. Phorbolin I
Gene Name APOBEC3C
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Host cellular restriction factor that may have antiviral activities against exogenous and endogenous viruses, as well as retrotransposons. May also play a role in the epigenetic regulation of gene expression through the process of active DNA demethylation.
Pathways Not Available
Reactions
Cytidine + Water → Uridine + Ammonia details
GO Classification
Biological Process
defense response to virus
DNA demethylation
negative regulation of transposition
virus-host interaction
Molecular Function
metal ion binding
zinc ion binding
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 22825.725
Theoretical pI 7.59
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|22907039|ref|NP_055323.2| DNA dC->dU-editing enzyme APOBEC-3C [Homo sapiens]
MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVD
SETHCHAERC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NRW3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17353
References
General References Not Available