Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11596
Secondary Accession Numbers None
Name DNA dC->dU-editing enzyme APOBEC-3G
Synonyms
  1. APOBEC-related cytidine deaminase
  2. APOBEC-related protein 9
  3. CEM-15
  4. Deoxycytidine deaminase
  5. APOBEC-related protein
  6. ARCD
  7. ARP-9
  8. CEM15
Gene Name APOBEC3G
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA deaminase (cytidine deaminase) that mediates a form of innate resistance to retroviral infections (at least to HIV-1 infection) by triggering G-to-A hypermutation in the newly synthesized viral DNA. The replacements C-to-U in the minus strand DNA of HIV-1 during reverse transcription, leads to G-to-A transitions in the plus strand. The inhibition of viral replication is either due to the degradation of the minus strand before its integration or to the lethality of the hypermutations. Modification of both DNA strands is not excluded. This antiviral activity is neutralized by the virion infectivity factor (VIF), that prevents the incorporation of APOBEC3G into progeny HIV-1 virions by both inhibiting its translation and/or by inducing its ubiquitination and subsequent degradation by the 26S proteasome. May also prevent the transposition of a subset of retroelements. Binds a variety of RNAs, but does not display detectable APOB, NF1 and NAT1 mRNA editing.
Pathways Not Available
Reactions
Deoxycytidine + Water → Deoxyuridine + Ammonia details
GO Classification
Biological Process
defense response to virus
DNA cytosine deamination
innate immune response
negative regulation of transposition
virus-host interaction
base conversion or substitution editing
negative regulation of retroviral genome replication
positive regulation of defense response to virus by host
viral reproduction
Cellular Component
cytosol
mitochondrion
apolipoprotein B mRNA editing enzyme complex
Molecular Function
metal ion binding
cytidine deaminase activity
zinc ion binding
RNA binding
deoxycytidine deaminase activity
protein homodimerization activity
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q13.1-q13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 11822.52
Theoretical pI 11.133
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|54873619|ref|NP_001006667.1| DNA dC->dU-editing enzyme APOBEC-3F isoform b [Homo sapiens]
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPR
SFIRAPFQVL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HC16
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17357
References
General References Not Available