Showing Protein 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 (HMDBP11598)
Identification | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11598 | |||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||
Name | 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 | |||||||||||||||
Synonyms |
|
|||||||||||||||
Gene Name | ABHD5 | |||||||||||||||
Protein Type | Unknown | |||||||||||||||
Biological Properties | ||||||||||||||||
General Function | Not Available | |||||||||||||||
Specific Function | Lysophosphatidic acid acyltransferase which functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. | |||||||||||||||
Pathways | Not Available | |||||||||||||||
Reactions |
|
|||||||||||||||
GO Classification |
|
|||||||||||||||
Cellular Location | Not Available | |||||||||||||||
Gene Properties | ||||||||||||||||
Chromosome Location | 3 | |||||||||||||||
Locus | 3p21 | |||||||||||||||
SNPs | Not Available | |||||||||||||||
Gene Sequence | Not Available | |||||||||||||||
Protein Properties | ||||||||||||||||
Number of Residues | Not Available | |||||||||||||||
Molecular Weight | 39095.34 | |||||||||||||||
Theoretical pI | 6.615 | |||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||
Signals | Not Available | |||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||
Protein Sequence |
>>gi|31542303|ref|NP_057090.2| 1-acylglycerol-3-phosphate O-acyltransferase ABHD5 [Homo sapiens] MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNG NKIWTLKFSH |
|||||||||||||||
External Links | ||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||
UniProtKB/Swiss-Prot ID | Q8WTS1 | |||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||
PDB IDs | Not Available | |||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||
GeneCard ID | Not Available | |||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||
HGNC ID | HGNC:21396 | |||||||||||||||
References | ||||||||||||||||
General References | Not Available |