Showing Protein Mycophenolic acid acyl-glucuronide esterase, mitochondrial (HMDBP11600)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11600 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Mycophenolic acid acyl-glucuronide esterase, mitochondrial | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | ABHD10 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Catalyzes the deglucuronidation of mycophenolic acid acyl-glucuronide, a metabolite of the immunosuppressant drug mycophenolate. | |||||||||
| Pathways | Not Available | |||||||||
| Reactions |
|
|||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 3 | |||||||||
| Locus | 3q13.2 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 33932.165 | |||||||||
| Theoretical pI | 8.578 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|8923001|ref|NP_060864.1| mycophenolic acid acyl-glucuronide esterase, mitochondrial isoform 1 precursor [Homo sapiens] MAVARLAAVAAWVPCRSWGWAAVPFGPHRGLSVLLARIPQRAPRWLPACRQKTSLSFLNR PDLPNLAYKK |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q9NUJ1 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:25656 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||