You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11601
Secondary Accession Numbers None
Name Acyl-coenzyme A thioesterase THEM5
Synonyms
  1. Acyl-CoA thioesterase THEM5
  2. Acyl-coenzyme A thioesterase 15
  3. Thioesterase superfamily member 5
Gene Name THEM5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Has acyl-CoA thioesterase activity towards long-chain (C16 and C18) fatty acyl-CoA substrates, with a preference for linoleyl-CoA and other unsaturated long-chain fatty acid-CoA esters. Plays an important role in mitochondrial fatty acid metabolism, and in remodeling of the mitochondrial lipid cardiolipin. Required for normal mitochondrial function.
Pathways Not Available
Reactions
hexadecanoyl-CoA + Water → Coenzyme A + Palmitic acid details
GO Classification
Biological Process
fatty acid metabolic process
cardiolipin acyl-chain remodeling
long-chain fatty-acyl-CoA metabolic process
Cellular Component
mitochondrial matrix
Molecular Function
palmitoyl-CoA hydrolase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27662.51
Theoretical pI 7.716
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|32698978|ref|NP_872384.1| acyl-coenzyme A thioesterase THEM5 [Homo sapiens]
MIRRCFQVAARLGHHRGLLEAPRILPRLNPASAFGSSTDSMFSRFLPEKTDLKDYALPNA
SWCSDMLSLY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N1Q8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26755
References
General References Not Available