Hmdb loader

Showing Protein Acyl-CoA synthetase short-chain family member 3, mitochondrial (HMDBP11602)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 9 metabolites
Identification
HMDB Protein ID HMDBP11602
Secondary Accession Numbers None
Name Acyl-CoA synthetase short-chain family member 3, mitochondrial
Synonyms
  1. Acyl-CoA synthetase short-chain family member 3
Gene Name ACSS3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Activates acetate so that it can be used for lipid synthesis or for energy generation (By similarity).
Pathways
  • Malonic Aciduria
  • Malonyl-coa decarboxylase deficiency
  • Methylmalonic Aciduria Due to Cobalamin-Related Disorders
  • Mitochondrial Beta-Oxidation of Short Chain Saturated Fatty Acids
  • Propanoate metabolism
  • Propanoate metabolism
  • Short-chain 3-hydroxyacyl-CoA dehydrogenase deficiency (SCHAD)
Reactions
Adenosine triphosphate + Acetic acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + Acetyl-CoA details
Propinol adenylate + Coenzyme A → Adenosine monophosphate + Propionyl-CoA details
Adenosine triphosphate + Propionic acid → Pyrophosphate + Propinol adenylate details
GO Classification
Cellular Component
mitochondrion
Molecular Function
ATP binding
acetate-CoA ligase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q21.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 74777.655
Theoretical pI 8.638
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|13375727|ref|NP_078836.1| acyl-CoA synthetase short-chain family member 3, mitochondrial precursor [Homo sapiens]
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H6R3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:24723
References
General References Not Available