Showing Protein Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase (HMDBP11603)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11603 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Manganese-dependent ADP-ribose/CDP-alcohol diphosphatase | ||||||||
| Synonyms |
|
||||||||
| Gene Name | ADPRM | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Hydrolyzes ADP-ribose, IDP-ribose, CDP-glycerol, CDP-choline and CDP-ethanolamine, but not other non-reducing ADP-sugars or CDP-glucose. May be involved in immune cell signaling as suggested by the second-messenger role of ADP-ribose, which activates TRPM2 as a mediator of oxidative/nitrosative stress (By similarity). | ||||||||
| Pathways |
|
||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 17 | ||||||||
| Locus | 17p13.1 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 39529.105 | ||||||||
| Theoretical pI | 5.588 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|94158594|ref|NP_064618.3| manganese-dependent ADP-ribose/CDP-alcohol diphosphatase [Homo sapiens] MDDKPNPEALSDSSERLFSFGVIADVQFADLEDGFNFQGTRRRYYRHSLLHLQGAIEDWN NESSMPCCVL |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q3LIE5 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:30925 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||