| Identification |
| HMDB Protein ID
| HMDBP11607 |
| Secondary Accession Numbers
| None |
| Name
| 1,5-anhydro-D-fructose reductase |
| Synonyms
|
- AF reductase
- Aldo-keto reductase family 1 member C-like protein 2
- Aldo-keto reductase family 1 member E2
- LoopADR
- Testis-specific protein
- hTSP
|
| Gene Name
| AKR1E2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol. Can also catalyze the reduction of various aldehydes and quinones (By similarity). Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro).
|
| Pathways
|
Not Available
|
| Reactions
|
| 1,5-Anhydrosorbitol + NADP → D-1,5-Anhydrofructose + NADPH |
details
|
|
| GO Classification
|
| Cellular Component |
| cytoplasm |
| Molecular Function |
| 1,5-anhydro-D-fructose reductase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 10 |
| Locus
| 10p15.1 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 36588.935 |
| Theoretical pI
| 7.493 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|93277124|ref|NP_001035267.1| 1,5-anhydro-D-fructose reductase isoform 1 [Homo sapiens]
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVR
REDLFIATKL
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96JD6 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:23437 |
| References |
| General References
| Not Available |