Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11607
Secondary Accession Numbers None
Name 1,5-anhydro-D-fructose reductase
Synonyms
  1. AF reductase
  2. Aldo-keto reductase family 1 member C-like protein 2
  3. Aldo-keto reductase family 1 member E2
  4. LoopADR
  5. Testis-specific protein
  6. hTSP
Gene Name AKR1E2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the NADPH-dependent reduction of 1,5-anhydro-D-fructose (AF) to 1,5-anhydro-D-glucitol. Can also catalyze the reduction of various aldehydes and quinones (By similarity). Has low NADPH-dependent reductase activity towards 9,10-phenanthrenequinone (in vitro).
Pathways Not Available
Reactions
1,5-Anhydrosorbitol + NADP → D-1,5-Anhydrofructose + NADPH details
GO Classification
Cellular Component
cytoplasm
Molecular Function
1,5-anhydro-D-fructose reductase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10p15.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 36588.935
Theoretical pI 7.493
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|93277124|ref|NP_001035267.1| 1,5-anhydro-D-fructose reductase isoform 1 [Homo sapiens]
MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVR
REDLFIATKL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96JD6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23437
References
General References Not Available