You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11613
Secondary Accession Numbers None
Name Alkylglycerol monooxygenase
Synonyms
  1. Transmembrane protein 195
Gene Name AGMO
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Glyceryl-ether monooxygenase that cleaves the O-alkyl bond of ether lipids. Ether lipids are essential components of brain membranes.
Pathways Not Available
Reactions
1-alkyl-sn-glycerol + L-erythro-tetrahydrobiopterin + Oxygen → 1-O-alkyl-sn-glycerol + Dihydrobiopterin + Water details
GO Classification
Biological Process
ether lipid metabolic process
membrane lipid metabolic process
fatty acid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
endoplasmic reticulum
integral to membrane
Molecular Function
glyceryl-ether monooxygenase activity
iron ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7p21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 51499.41
Theoretical pI 7.919
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|51972212|ref|NP_001004320.1| alkylglycerol monooxygenase [Homo sapiens]
MKNPEAQQDVSVSQGFRMLFYTMKPSETSFQTLEEVPDYVKKATPFFISLMLLELVVSWI
LKGKPPGRLD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6ZNB7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:33784
References
General References Not Available