Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11619
Secondary Accession Numbers None
Name Activating signal cointegrator 1 complex subunit 3
Synonyms
  1. ASC-1 complex subunit p200
  2. Helicase, ATP binding 1
  3. Trip4 complex subunit p200
  4. ASC1p200
Gene Name ASCC3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function 3'-5' DNA helicase involved in repair of alkylated DNA. Promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3, enabling ALKHB3 to process alkylated N3-methylcytosine (3mC) within double-stranded regions. Enhances NF-kappa-B, SRF and AP1 transactivation.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
cell proliferation
DNA dealkylation involved in DNA repair
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
cytoplasm
nucleus
Molecular Function
ATP-dependent 3'-5' DNA helicase activity
nucleic acid binding
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q16
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 251458.205
Theoretical pI 7.099
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|76880486|ref|NP_006819.2| activating signal cointegrator 1 complex subunit 3 isoform a [Homo sapiens]
MALPRLTGALRSFSNVTKQDNYNEEVADLKIKRSKLHEQVLDLGLTWKKIIKFLNEKLEK
SKMQSINEDL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N3C0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18697
References
General References Not Available