Hmdb loader
Identification
HMDB Protein ID HMDBP11620
Secondary Accession Numbers None
Name Probable cation-transporting ATPase 13A1
Synonyms Not Available
Gene Name ATP13A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
ATP catabolic process
cation transport
Cellular Component
integral to membrane
Molecular Function
metal ion binding
ATP binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 132953.465
Theoretical pI 8.139
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|170016077|ref|NP_065143.2| probable cation-transporting ATPase 13A1 [Homo sapiens]
MAAAAAVGNAVPCGARPCGVRPDGQPKPGPQPRALLAAGPALIANGDELVAAVWPYRRLA
LLRRLTVLPF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HD20
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:24215
References
General References Not Available