Showing Protein Probable cation-transporting ATPase 13A2 (HMDBP11621)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11621 | ||||||||||
| Secondary Accession Numbers | None | ||||||||||
| Name | Probable cation-transporting ATPase 13A2 | ||||||||||
| Synonyms | Not Available | ||||||||||
| Gene Name | ATP13A2 | ||||||||||
| Protein Type | Unknown | ||||||||||
| Biological Properties | |||||||||||
| General Function | Not Available | ||||||||||
| Specific Function | May play a role in intracellular cation homeostasis and the maintenance of neuronal integrity. | ||||||||||
| Pathways | Not Available | ||||||||||
| Reactions |
|
||||||||||
| GO Classification |
|
||||||||||
| Cellular Location | Not Available | ||||||||||
| Gene Properties | |||||||||||
| Chromosome Location | 1 | ||||||||||
| Locus | 1p36 | ||||||||||
| SNPs | Not Available | ||||||||||
| Gene Sequence | Not Available | ||||||||||
| Protein Properties | |||||||||||
| Number of Residues | Not Available | ||||||||||
| Molecular Weight | 128321.79 | ||||||||||
| Theoretical pI | 8.124 | ||||||||||
| Pfam Domain Function |
|
||||||||||
| Signals | Not Available | ||||||||||
| Transmembrane Regions | Not Available | ||||||||||
| Protein Sequence |
>>gi|213972619|ref|NP_001135445.1| probable cation-transporting ATPase 13A2 isoform 2 [Homo sapiens] MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI PLLLFRWKPL |
||||||||||
| External Links | |||||||||||
| GenBank ID Protein | Not Available | ||||||||||
| UniProtKB/Swiss-Prot ID | Q9NQ11 | ||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
| PDB IDs | Not Available | ||||||||||
| GenBank Gene ID | Not Available | ||||||||||
| GeneCard ID | Not Available | ||||||||||
| GenAtlas ID | Not Available | ||||||||||
| HGNC ID | HGNC:30213 | ||||||||||
| References | |||||||||||
| General References | Not Available | ||||||||||