Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11621
Secondary Accession Numbers None
Name Probable cation-transporting ATPase 13A2
Synonyms Not Available
Gene Name ATP13A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role in intracellular cation homeostasis and the maintenance of neuronal integrity.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
ATP catabolic process
cation transport
Cellular Component
lysosome
integral to membrane
Molecular Function
metal ion binding
ATP binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p36
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 128321.79
Theoretical pI 8.124
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|213972619|ref|NP_001135445.1| probable cation-transporting ATPase 13A2 isoform 2 [Homo sapiens]
MSADSSPLVGSTPTGYGTLTIGTSIDPLSSSVSSVRLSGYCGSPWRVIGYHVVVWMMAGI
PLLLFRWKPL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQ11
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30213
References
General References Not Available