Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11625
Secondary Accession Numbers None
Name ATPase family AAA domain-containing protein 1
Synonyms
  1. Thorase
Gene Name ATAD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent (By similarity).
Pathways
  • Adenine phosphoribosyltransferase deficiency (APRT)
  • Adenosine Deaminase Deficiency
  • Adenylosuccinate Lyase Deficiency
  • AICA-Ribosiduria
  • Azathioprine Action Pathway
  • Gout or Kelley-Seegmiller Syndrome
  • Lesch-Nyhan Syndrome (LNS)
  • Mercaptopurine Action Pathway
  • Mitochondrial DNA depletion syndrome
  • Molybdenum Cofactor Deficiency
  • Myoadenylate deaminase deficiency
  • Purine metabolism
  • Purine Nucleoside Phosphorylase Deficiency
  • Thioguanine Action Pathway
  • Xanthine Dehydrogenase Deficiency (Xanthinuria)
  • Xanthinuria type I
  • Xanthinuria type II
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
memory
learning
negative regulation of synaptic transmission, glutamatergic
positive regulation of receptor internalization
Cellular Component
mitochondrion
plasma membrane
cell junction
postsynaptic membrane
peroxisomal membrane
Molecular Function
ATP binding
ATPase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q23.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 40743.65
Theoretical pI 6.907
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|31377644|ref|NP_116199.2| ATPase family AAA domain-containing protein 1 [Homo sapiens]
MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMK
QIGVKNVKLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NBU5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25903
References
General References Not Available