You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11625 |
Secondary Accession Numbers
| None |
Name
| ATPase family AAA domain-containing protein 1 |
Synonyms
|
- Thorase
|
Gene Name
| ATAD1 |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| ATPase that plays a critical role in regulating the surface expression of AMPA receptors (AMPAR), thereby regulating synaptic plasticity and learning and memory. Required for NMDA-stimulated AMPAR internalization and inhibition of GRIA1 and GRIA2 recycling back to the plasma membrane; these activities are ATPase-dependent (By similarity).
|
Pathways
|
- Adenine phosphoribosyltransferase deficiency (APRT)
- Adenosine Deaminase Deficiency
- Adenylosuccinate Lyase Deficiency
- AICA-Ribosiduria
- Azathioprine Action Pathway
- Gout or Kelley-Seegmiller Syndrome
- Lesch-Nyhan Syndrome (LNS)
- Mercaptopurine Action Pathway
- Mitochondrial DNA depletion syndrome
- Molybdenum Cofactor Deficiency
- Myoadenylate deaminase deficiency
- Purine metabolism
- Purine Nucleoside Phosphorylase Deficiency
- Thioguanine Action Pathway
- Xanthine Dehydrogenase Deficiency (Xanthinuria)
- Xanthinuria type I
- Xanthinuria type II
|
Reactions
|
Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
GO Classification
|
Biological Process |
memory |
learning |
negative regulation of synaptic transmission, glutamatergic |
positive regulation of receptor internalization |
Cellular Component |
mitochondrion |
plasma membrane |
cell junction |
postsynaptic membrane |
peroxisomal membrane |
Molecular Function |
ATP binding |
ATPase activity |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 10 |
Locus
| 10q23.31 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 40743.65 |
Theoretical pI
| 6.907 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|31377644|ref|NP_116199.2| ATPase family AAA domain-containing protein 1 [Homo sapiens]
MVHAEAFSRPLSRNEVVGLIFRLTIFGAVTYFTIKWMVDAIDPTRKQKVEAQKQAEKLMK
QIGVKNVKLS
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| Q8NBU5 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:25903 |
References |
General References
| Not Available |