Hmdb loader

Showing Protein ATPase family AAA domain-containing protein 2 (HMDBP11626)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 4 metabolites
Identification
HMDB Protein ID HMDBP11626
Secondary Accession Numbers None
Name ATPase family AAA domain-containing protein 2
Synonyms
  1. AAA nuclear coregulator cancer-associated protein
  2. ANCCA
Gene Name ATAD2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
ATP catabolic process
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
nucleus
Molecular Function
ATP binding
ATPase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q24.13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 158552.525
Theoretical pI 6.32
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|24497618|ref|NP_054828.2| ATPase family AAA domain-containing protein 2 [Homo sapiens]
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
SVKEVETYHR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6PL18
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30123
References
General References Not Available