You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11627
Secondary Accession Numbers None
Name Alpha-tubulin N-acetyltransferase
Synonyms
  1. Alpha-TAT
  2. TAT
  3. Acetyltransferase mec-17 homolog
Gene Name ATAT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Specifically acetylates 'Lys-40' in alpha-tubulin on the lumenal side of microtubules. May affect microtubule stability and regulate microtubule dynamics. May be involved in neuron development.
Pathways Not Available
Reactions
Acetyl-CoA + [alpha-tubulin]-L-lysine → Coenzyme A + [alpha-tubulin]-N(6)-acetyl-L-lysine details
GO Classification
Molecular Function
tubulin N-acetyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 45573.35
Theoretical pI 9.69
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|72534730|ref|NP_001026892.1| alpha-tubulin N-acetyltransferase isoform 1 precursor [Homo sapiens]
MWLTWPFCFLTITLREEGVCHLESVDLQQQIMTIIDELGKASAKAQNLSAPITSASRMQS
NRHVVYILKD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5SQI0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21186
References
General References Not Available