Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11629
Secondary Accession Numbers None
Name Adenosine deaminase CECR1
Synonyms
  1. Cat eye syndrome critical region protein 1
Gene Name CECR1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Adenosine deaminase that may contribute to the degradation of extracellular adenosine, a signaling molecule that controls a variety of cellular responses. Requires elevated adenosine levels for optimal enzyme activity. Binds to cell surfaces via proteoglycans and may play a role in the regulation of cell proliferation and differentiation, independently of its enzyme activity.
Pathways Not Available
Reactions
Adenosine + Water → Inosine + Ammonia details
GO Classification
Biological Process
multicellular organismal development
adenosine catabolic process
hypoxanthine salvage
inosine biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
Cellular Component
Golgi apparatus
extracellular space
Molecular Function
metal ion binding
adenosine receptor binding
growth factor activity
proteoglycan binding
zinc ion binding
heparin binding
adenosine deaminase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 58933.1
Theoretical pI 7.907
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|29029550|ref|NP_059120.2| adenosine deaminase CECR1 isoform a precursor [Homo sapiens]
MLVDGPSERPALCFLLLAVAMSFFGSALSIDETRAHLLLKEKMMRLGGRLVLNTKEELAN
ERLMTLKIAE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NZK5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:1839
References
General References Not Available