Hmdb loader
Identification
HMDB Protein ID HMDBP11634
Secondary Accession Numbers None
Name Cyclic GMP-AMP synthase
Synonyms
  1. cGAMP synthase
  2. cGAS
  3. h-cGAS
  4. Mab-21 domain-containing protein 1
Gene Name MB21D1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Nucleotidyltransferase that catalyzes formation of cyclic GMP-AMP (cGAMP) from ATP and GTP and exhibits antiviral activity. Has antiviral activity by acting as a key cytosolic DNA sensor, the presence of DNA in the cytoplasm being a danger signal that triggers the immune responses. Binds cytosolic DNA directly, leading to activation and synthesis of cGAMP, a second messenger that binds to and activates TMEM173/STING, thereby triggering type-I interferon production.
Pathways Not Available
Reactions
Adenosine triphosphate + Guanosine triphosphate → Pyrophosphate + cyclic GMP-AMP details
GO Classification
Biological Process
defense response to virus
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 58813.885
Theoretical pI 9.488
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|115511030|ref|NP_612450.2| cyclic GMP-AMP synthase [Homo sapiens]
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
QKKSAPDTQE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N884
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21367
References
General References Not Available