You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11645
Secondary Accession Numbers None
Name Chromodomain-helicase-DNA-binding protein 8
Synonyms
  1. CHD-8
  2. ATP-dependent helicase CHD8
  3. Helicase with SNF2 domain 1
Gene Name CHD8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA helicase that acts as a chromatin remodeling factor and regulates transcription. Acts as a transcription repressor by remodeling chromatin structure and recruiting histone H1 to target genes. Suppresses p53/TP53-mediated apoptosis by recruiting histone H1 and preventing p53/TP53 transactivation activity. Acts as a negative regulator of Wnt signaling pathway by regulating beta-catenin (CTNNB1) activity. Negatively regulates CTNNB1-targeted gene expression by being recruited specifically to the promoter regions of several CTNNB1 responsive genes. Involved in both enhancer blocking and epigenetic remodeling at chromatin boundary via its interaction with CTCF. Acts as a suppressor of STAT3 activity by suppressing the LIF-induced STAT3 transcriptional activity. Also acts as a transcription activator via its interaction with ZNF143 by participating in efficient U6 RNA polymerase III transcription.
Pathways
  • Wnt signaling pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
negative regulation of apoptotic process
in utero embryonic development
negative regulation of transcription, DNA-dependent
ATP-dependent chromatin remodeling
canonical Wnt receptor signaling pathway
negative regulation of Wnt receptor signaling pathway
positive regulation of transcription from RNA polymerase II promoter
positive regulation of transcription from RNA polymerase III promoter
transcription, DNA-dependent
Cellular Component
MLL1 complex
Molecular Function
ATP binding
methylated histone residue binding
DNA-dependent ATPase activity
p53 binding
beta-catenin binding
DNA helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 290516.69
Theoretical pI 6.471
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|282165704|ref|NP_001164100.1| chromodomain-helicase-DNA-binding protein 8 isoform 1 [Homo sapiens]
MADPIMDLFDDPNLFGLDSLTDDSFNQVTQDPIEEALGLPSSLDSLDQMNQDGGGGDVGN
SSASELVPPP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HCK8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20153
References
General References Not Available