Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11647
Secondary Accession Numbers None
Name Calmodulin-lysine N-methyltransferase
Synonyms
  1. CLNMT
  2. CaM KMT
Gene Name CAMKMT
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the trimethylation of 'Lys-116' in calmodulin.
Pathways Not Available
Reactions
S-Adenosylmethionine + calmodulin L-lysine → S-Adenosylhomocysteine + calmodulin N(6)-methyl-L-lysine details
GO Classification
Cellular Component
cytoplasm
Molecular Function
calmodulin-lysine N-methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2p21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 36127.88
Theoretical pI 6.831
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|13376109|ref|NP_079042.1| calmodulin-lysine N-methyltransferase [Homo sapiens]
MESRVADAGTGETARAAGGSPAVGCTTRGPVVSAPLGAARWKLLRQVLKQKHLDDCLRHV
SVRRFESFNL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q7Z624
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26276
References
General References Not Available