Hmdb loader

Showing Protein Steroid 21-hydroxylase (HMDBP11648)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 17 metabolites
Identification
HMDB Protein ID HMDBP11648
Secondary Accession Numbers None
Name Steroid 21-hydroxylase
Synonyms
  1. 21-OHase
  2. Cytochrome P-450c21
  3. Cytochrome P450 21
  4. Cytochrome P450 XXI
  5. Cytochrome P450-C21
  6. Cytochrome P450-C21B
Gene Name CYP21A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Specifically catalyzes the 21-hydroxylation of steroids. Required for the adrenal synthesis of mineralocorticoids and glucocorticoids.
Pathways
  • 11-beta-hydroxylase deficiency (CYP11B1)
  • 17-alpha-hydroxylase deficiency (CYP17)
  • 21-hydroxylase deficiency (CYP21)
  • 3-Beta-Hydroxysteroid Dehydrogenase Deficiency
  • Adrenal Hyperplasia Type 3 or Congenital Adrenal Hyperplasia due to 21-hydroxylase Deficiency
  • Adrenal Hyperplasia Type 5 or Congenital Adrenal Hyperplasia due to 17 Alpha-hydroxylase Deficiency
  • Apparent mineralocorticoid excess syndrome
  • Congenital Lipoid Adrenal Hyperplasia (CLAH) or Lipoid CAH
  • Corticosterone methyl oxidase I deficiency (CMO I)
  • Corticosterone methyl oxidase II deficiency - CMO II
  • Steroid hormone biosynthesis
  • Steroidogenesis
Reactions
A steroid + AH(2) + Oxygen → a 21-hydroxysteroid + A + Water details
Progesterone + Reduced acceptor + Oxygen → Deoxycorticosterone + Acceptor + Water details
21-Deoxycortisol + Reduced acceptor + Oxygen → Cortisol + Acceptor + Water details
17-Hydroxyprogesterone + Reduced acceptor + Oxygen → Cortexolone + Acceptor + Water details
Pregnenolone + Reduced acceptor + Oxygen → 21-Hydroxypregnenolone + Acceptor + Water details
11beta-Hydroxyprogesterone + Reduced acceptor + Oxygen → Corticosterone + Acceptor + Water details
17a-Hydroxypregnenolone + NADPH + Hydrogen Ion + Oxygen → 17alpha,21-Dihydroxypregnenolone + NADP + Water details
GO Classification
Biological Process
small molecule metabolic process
xenobiotic metabolic process
glucocorticoid biosynthetic process
mineralocorticoid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
Molecular Function
electron carrier activity
iron ion binding
steroid hydroxylase activity
steroid 21-monooxygenase activity
heme binding
steroid binding
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56000.94
Theoretical pI 7.818
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|323510663|ref|NP_000491.4| steroid 21-hydroxylase isoform a [Homo sapiens]
MLLLGLLLLLPLLAGARLLWNWWKLRSLHLPPLAPGFLHLLQPDLPIYLLGLTQKFGPIY
RLHLGLQDVV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P08686
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2600
References
General References Not Available