You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11652
Secondary Accession Numbers None
Name Choline transporter-like protein 5
Synonyms
  1. Solute carrier family 44 member 5
Gene Name SLC44A5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
phosphatidylcholine biosynthetic process
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p31.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 81561.09
Theoretical pI 8.057
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|194239633|ref|NP_001123530.1| choline transporter-like protein 5 isoform B [Homo sapiens]
MNDTEKPADTPSEEEDFGDPRTYDPDFKGPVANRSCTDVLCCMIFLLCIIGYIVLGLVAW
VHGDPRRAAY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NCS7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28524
References
General References Not Available