You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11654
Secondary Accession Numbers None
Name m7GpppX diphosphatase
Synonyms
  1. DCS-1
  2. Decapping scavenger enzyme
  3. Hint-related 7meGMP-directed hydrolase
  4. Histidine triad nucleotide-binding protein 5
  5. Histidine triad protein member 5
  6. Scavenger mRNA-decapping enzyme DcpS
  7. HINT-5
Gene Name DCPS
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Decapping scavenger enzyme that catalyzes the cleavage of a residual cap structure following the degradation of mRNAs by the 3'->5' exosome-mediated mRNA decay pathway. Hydrolyzes cap analog structures like 7-methylguanosine nucleoside triphosphate (m7GpppG) with up to 10 nucleotide substrates (small capped oligoribonucleotides) and specifically releases 5'-phosphorylated RNA fragments and 7-methylguanosine monophosphate (m7GMP). Cleaves cap analog structures like tri-methyl guanosine nucleoside triphosphate (m3(2,2,7)GpppG) with very poor efficiency. Does not hydrolyze unmethylated cap analog (GpppG) and shows no decapping activity on intact m7GpppG-capped mRNA molecules longer than 25 nucleotides. Does not hydrolyze 7-methylguanosine diphosphate (m7GDP) to m7GMP (PubMed:22985415). May also play a role in the 5'->3 mRNA decay pathway; m7GDP, the downstream product released by the 5'->3' mRNA mediated decapping activity, may be also converted by DCPS to m7GMP (PubMed:14523240). Binds to m7GpppG and strongly to m7GDP. Plays a role in first intron splicing of pre-mRNAs. Inhibits activation-induced cell death.
Pathways
  • RNA degradation
Reactions
M(7)G5'ppp5'N(3'ppp5'N)(n) + Water → 7-Methylguanosine 5'-phosphate + pp5'N(3'ppp5'N)(n) details
7-Methylguanosine 5'-diphosphate + Water → 7-Methylguanosine 5'-phosphate + Phosphoric acid details
GO Classification
Biological Process
exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
cellular response to menadione
deadenylation-dependent decapping of nuclear-transcribed mRNA
mRNA cis splicing, via spliceosome
negative regulation of programmed cell death
Cellular Component
cytosol
mitochondrion
nucleus
Molecular Function
m7G(5')pppN diphosphatase activity
RNA 7-methylguanosine cap binding
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q24.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 38608.45
Theoretical pI 6.377
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7661734|ref|NP_054745.1| m7GpppX diphosphatase [Homo sapiens]
MADAAPQLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDK
IIFLHGKVNE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96C86
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29812
References
General References Not Available