You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11655
Secondary Accession Numbers None
Name dCTP pyrophosphatase 1
Synonyms
  1. Deoxycytidine-triphosphatase 1
  2. RS21C6
  3. XTP3-transactivated gene A protein
  4. dCTPase 1
Gene Name DCTPP1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. Has a strong preference for modified dCTP. Activity is highest with 5-iodo-dCTP, followed by 5-bromo-dCTP, unmodified dCTP, 5-methyl-dCTP and 5-chloro-dCTP. Hydrolyzes 2-chloro-dATP and 2-hydroxy-dATP with lower efficiency, and has even lower activity with unmodified dATP, dTTP and dUTP (in vitro). Does not hydrolyze ATP, UTP, ITP, GTP, dADP, dCDP or dGTP. May protect DNA or RNA against the incorporation of non-canonical nucleotide triphosphates. May protect cells against inappropriate methylation of CpG islands by DNA methyltransferases (By similarity).
Pathways Not Available
Reactions
dCTP + Water → dCMP + Pyrophosphate details
GO Classification
Biological Process
nucleoside triphosphate catabolic process
protein homotetramerization
Cellular Component
cytosol
Molecular Function
magnesium ion binding
dCTP diphosphatase activity
nucleoside-triphosphate diphosphatase activity
pyrimidine deoxyribonucleotide binding
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16p11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 18680.645
Theoretical pI 5.031
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|13129100|ref|NP_077001.1| dCTP pyrophosphatase 1 [Homo sapiens]
MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLAL
VGEVGELAEL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H773
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:28777
References
General References Not Available