Hmdb loader
Identification
HMDB Protein ID HMDBP11656
Secondary Accession Numbers None
Name ATP-dependent RNA helicase DDX19A
Synonyms
  1. DDX19-like protein
  2. DEAD box protein 19A
Gene Name DDX19A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent RNA helicase involved in mRNA export from the nucleus. Rather than unwinding RNA duplexes, DDX19 functions as a remodeler of ribonucleoprotein particles, whereby proteins bound to nuclear mRNA are dissociated and replaced by cytoplasmic mRNA binding proteins (By similarity).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
mRNA transport
protein transport
Cellular Component
cytoplasm
nuclear pore
nuclear membrane
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 53974.595
Theoretical pI 6.582
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|8922886|ref|NP_060802.1| ATP-dependent RNA helicase DDX19A [Homo sapiens]
MATDSWALAVDEQEAAVKSMTNLQIKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSL
LNKLIRSNLV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NUU7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25628
References
General References Not Available