| Identification |
|---|
| HMDB Protein ID
| HMDBP11659 |
| Secondary Accession Numbers
| None |
| Name
| Probable ATP-dependent RNA helicase DDX11 |
| Synonyms
|
- CHL1-related protein 1
- DEAD/H box protein 11
- Keratinocyte growth factor-regulated gene 2 protein
- hCHLR1
- KRG-2
|
| Gene Name
| DDX11 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA helicase involved in cellular proliferation. Possesses DNA-dependent ATPase and helicase activities. This helicase translocates on single-stranded DNA in the 5' to 3' direction in the presence of ATP and, to a lesser extent, dATP. Its unwinding activity requires a 5'-single-stranded region for helicase loading, since flush-ended duplex structures do not support unwinding. The helicase activity is capable of displacing duplex regions up to 100 bp, which can be extended to 500 bp by RPA or the cohesion establishment factor, the Ctf18-RFC (replication factor C) complex activities. Stimulates the flap endonuclease activity of FEN1. Required for normal sister chromatid cohesion. Required for recruitment of bovine papillomavirus type 1 regulatory protein E2 to mitotic chrmosomes and for viral genome maintenance. Required for maintaining the chromosome segregation and is essential for embryonic development and the prevention of aneuploidy. May function during either S, G2, or M phase of the cell cycle. Binds to both single- and double-stranded DNA.
|
| Pathways
|
Not Available
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| positive regulation of cell proliferation |
| G2/M transition of mitotic cell cycle |
| mitotic sister chromatid segregation |
| S phase of mitotic cell cycle |
| sister chromatid cohesion |
| virus-host interaction |
| activation of signaling protein activity involved in unfolded protein response |
| Cellular Component |
| nucleolus |
| nucleoplasm |
| nuclear chromatin |
| midbody |
| spindle pole |
| Molecular Function |
| metal ion binding |
| ATP binding |
| 4 iron, 4 sulfur cluster binding |
| ATP-dependent DNA helicase activity |
| RNA binding |
| DNA-dependent ATPase activity |
| DNA helicase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 12 |
| Locus
| 12p11 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 108312.075 |
| Theoretical pI
| 7.313 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|380420356|ref|NP_001244073.1| probable ATP-dependent RNA helicase DDX11 isoform 3 [Homo sapiens]
MANETQKVGAIHFPFPFTPYSIQEDFMAELYRVLEAGKIGIFESPTGTGKSLSLICGALS
WLRDFEQKKR
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q96FC9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:2736 |
| References |
|---|
| General References
| Not Available |
