You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11664
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX20
Synonyms
  1. Component of gems 3
  2. DEAD box protein 20
  3. DEAD box protein DP 103
  4. Gemin-3
Gene Name DDX20
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. It may also play a role in the metabolism of snoRNPs.
Pathways
  • RNA transport
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
positive regulation of apoptotic process
assembly of spliceosomal tri-snRNP
induction of apoptosis
ncRNA metabolic process
negative regulation of transcription from RNA polymerase II promoter
Cellular Component
cytosol
cytoskeleton
nucleoplasm
Cajal body
spliceosomal complex
transcriptional repressor complex
Molecular Function
ATP-dependent RNA helicase activity
ATP binding
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p21.1-p13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 92239.715
Theoretical pI 6.952
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|256223453|ref|NP_009135.4| probable ATP-dependent RNA helicase DDX20 [Homo sapiens]
MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAE
PADFESLLLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UHI6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2743
References
General References Not Available