Hmdb loader
Identification
HMDB Protein ID HMDBP11665
Secondary Accession Numbers None
Name Nucleolar RNA helicase 2
Synonyms
  1. DEAD box protein 21
  2. Gu-alpha
  3. Nucleolar RNA helicase Gu
  4. Nucleolar RNA helicase II
  5. RH II/Gu
Gene Name DDX21
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Functions as cofactor for JUN-activated transcription. Involved in rRNA processing.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
response to exogenous dsRNA
response to virus
Cellular Component
nucleolus
Molecular Function
ATP-dependent RNA helicase activity
double-stranded RNA binding
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 79656.25
Theoretical pI 9.38
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|379317177|ref|NP_001243839.1| nucleolar RNA helicase 2 isoform 2 [Homo sapiens]
MNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAP
KPKKMKKEKE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NR30
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2744
References
General References Not Available