Showing Protein Nucleolar RNA helicase 2 (HMDBP11665)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11665 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Nucleolar RNA helicase 2 | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | DDX21 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Can unwind double-stranded RNA (helicase) and can fold or introduce a secondary structure to a single-stranded RNA (foldase). Functions as cofactor for JUN-activated transcription. Involved in rRNA processing. | |||||||||
| Pathways | Not Available | |||||||||
| Reactions |
|
|||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 10 | |||||||||
| Locus | 10q21 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 79656.25 | |||||||||
| Theoretical pI | 9.38 | |||||||||
| Pfam Domain Function |
|
|||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|379317177|ref|NP_001243839.1| nucleolar RNA helicase 2 isoform 2 [Homo sapiens] MNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAP KPKKMKKEKE |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q9NR30 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:2744 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||