Showing Protein ATP-dependent RNA helicase DDX25 (HMDBP11668)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11668 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | ATP-dependent RNA helicase DDX25 | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | DDX25 | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | ATP-dependent RNA helicase. Required for mRNA export and translation regulation during spermatid development (By similarity). | ||||||||||||
Pathways | Not Available | ||||||||||||
Reactions |
|
||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 11 | ||||||||||||
Locus | 11q24 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 54691.51 | ||||||||||||
Theoretical pI | 6.276 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|164419732|ref|NP_037396.3| ATP-dependent RNA helicase DDX25 [Homo sapiens] MASLLWGGDAGAAESERLNSHFSNLSQPRKNLWGIKSTAVRNIDGSINNINEDDEEDVVD LAANSLLNKL |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | Q9UHL0 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | |||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:18698 | ||||||||||||
References | |||||||||||||
General References | Not Available |