You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11673
Secondary Accession Numbers None
Name ATP-dependent RNA helicase DDX3Y
Synonyms
  1. DEAD box protein 3, Y-chromosomal
Gene Name DDX3Y
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable ATP-dependent RNA helicase. May play a role in spermatogenesis.
Pathways
  • Hepatitis B
  • RIG-I-like receptor signaling pathway
  • Viral carcinogenesis
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Cellular Component
cytoplasm
nucleus
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location Y
Locus Yq11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 73153.035
Theoretical pI 7.553
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|169881239|ref|NP_001116137.1| ATP-dependent RNA helicase DDX3Y [Homo sapiens]
MSHVVVKNDPELDQQLANLDLNSEKQSGGASTASKGRYIPPHLRNREASKGFHDKDSSGW
SCSKDKDAYS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O15523
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2699
References
General References Not Available