You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11674
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX41
Synonyms
  1. DEAD box protein 41
  2. DEAD box protein abstrakt homolog
Gene Name DDX41
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable ATP-dependent RNA helicase. Is required during post-transcriptional gene expression. May be involved in pre-mRNA splicing.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
multicellular organismal development
apoptotic process
cellular response to interferon-beta
mRNA splicing, via spliceosome
defense response to virus
positive regulation of transcription from RNA polymerase II promoter
Cellular Component
endoplasmic reticulum
catalytic step 2 spliceosome
Molecular Function
metal ion binding
ATP binding
ATP-dependent helicase activity
zinc ion binding
RNA binding
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q35.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 69837.015
Theoretical pI 6.84
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|21071032|ref|NP_057306.2| probable ATP-dependent RNA helicase DDX41 [Homo sapiens]
MEESEPERKRARTDEVPAGGSRSEAEDEDDEDYVPYVPLRQRRQLLLQKLLQRRRKGAAE
EEQQDSGSEP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UJV9
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18674
References
General References Not Available