Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11675
Secondary Accession Numbers None
Name ATP-dependent RNA helicase DDX42
Synonyms
  1. DEAD box protein 42
  2. RNA helicase-like protein
  3. RNA helicase-related protein
  4. SF3b DEAD box protein
  5. Splicing factor 3B-associated 125 kDa protein
  6. RHELP
  7. RNAHP
  8. SF3b125
Gene Name DDX42
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent RNA helicase. Binds to partially double-stranded RNAs (dsRNAs) in order to unwind RNA secondary structures. Unwinding is promoted in the presence of single-strand binding proteins. Mediates also RNA duplex formation thereby displacing the single-strand RNA binding protein. ATP and ADP modulate its activity: ATP binding and hydrolysis by DDX42 triggers RNA strand separation, whereas the ADP-bound form of the protein triggers annealing of complementary RNA strands. Involved in the survival of cells by interacting with TP53BP2 and thereby counteracting the apoptosis-stimulating activity of TP53BP2. Relocalizes TP53BP2 to the cytoplasm.
Pathways
  • Spliceosome
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
protein localization
Cellular Component
cytoplasm
nucleus
Cajal body
nuclear speck
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q23.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 102974.485
Theoretical pI 7.015
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|45446743|ref|NP_031398.2| ATP-dependent RNA helicase DDX42 [Homo sapiens]
MNWNKGGPGTKRGFGFGGFAISAGKKEEPKLPQQSHSAFGATSSSSGFGKSAPPQLPSFY
KIGSKRANFD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86XP3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18676
References
General References Not Available