Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11678
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX47
Synonyms
  1. DEAD box protein 47
Gene Name DDX47
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in apoptosis. May have a role in rRNA processing and mRNA splicing. Associates with pre-rRNA precursors.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
apoptotic process
mRNA processing
RNA splicing
rRNA processing
Cellular Component
nucleolus
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 50646.07
Theoretical pI 9.103
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|20149629|ref|NP_057439.2| probable ATP-dependent RNA helicase DDX47 isoform 1 [Homo sapiens]
MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ
GRDIIGLAET
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H0S4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18682
References
General References Not Available