Showing Protein Probable ATP-dependent RNA helicase DDX47 (HMDBP11678)
Identification | |||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11678 | ||||||||||||
Secondary Accession Numbers | None | ||||||||||||
Name | Probable ATP-dependent RNA helicase DDX47 | ||||||||||||
Synonyms |
|
||||||||||||
Gene Name | DDX47 | ||||||||||||
Protein Type | Unknown | ||||||||||||
Biological Properties | |||||||||||||
General Function | Not Available | ||||||||||||
Specific Function | Involved in apoptosis. May have a role in rRNA processing and mRNA splicing. Associates with pre-rRNA precursors. | ||||||||||||
Pathways | Not Available | ||||||||||||
Reactions |
|
||||||||||||
GO Classification |
|
||||||||||||
Cellular Location | Not Available | ||||||||||||
Gene Properties | |||||||||||||
Chromosome Location | 12 | ||||||||||||
Locus | 12p13.1 | ||||||||||||
SNPs | Not Available | ||||||||||||
Gene Sequence | Not Available | ||||||||||||
Protein Properties | |||||||||||||
Number of Residues | Not Available | ||||||||||||
Molecular Weight | 50646.07 | ||||||||||||
Theoretical pI | 9.103 | ||||||||||||
Pfam Domain Function | Not Available | ||||||||||||
Signals | Not Available | ||||||||||||
Transmembrane Regions | Not Available | ||||||||||||
Protein Sequence |
>>gi|20149629|ref|NP_057439.2| probable ATP-dependent RNA helicase DDX47 isoform 1 [Homo sapiens] MAAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ GRDIIGLAET |
||||||||||||
External Links | |||||||||||||
GenBank ID Protein | Not Available | ||||||||||||
UniProtKB/Swiss-Prot ID | Q9H0S4 | ||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
PDB IDs | |||||||||||||
GenBank Gene ID | Not Available | ||||||||||||
GeneCard ID | Not Available | ||||||||||||
GenAtlas ID | Not Available | ||||||||||||
HGNC ID | HGNC:18682 | ||||||||||||
References | |||||||||||||
General References | Not Available |