Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11680
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX4
Synonyms
  1. DEAD box protein 4
  2. Vasa homolog
Gene Name DDX4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role in germ cell development. May play a role in sperm motility.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
multicellular organismal development
spermatogenesis
leptotene
male meiosis I
sperm motility
regulation of protein localization
Cellular Component
perinuclear region of cytoplasm
nucleus
chromatoid body
pi-body
piP-body
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p15.2-p13.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 75820.165
Theoretical pI 5.494
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|216548263|ref|NP_001136021.1| probable ATP-dependent RNA helicase DDX4 isoform 2 [Homo sapiens]
MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFA
SGRNFGNRDA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQI0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18700
References
General References Not Available