You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Probable ATP-dependent RNA helicase DDX4 (HMDBP11680)
Identification | ||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11680 | |||||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||||
Name | Probable ATP-dependent RNA helicase DDX4 | |||||||||||||||||
Synonyms |
|
|||||||||||||||||
Gene Name | DDX4 | |||||||||||||||||
Protein Type | Unknown | |||||||||||||||||
Biological Properties | ||||||||||||||||||
General Function | Not Available | |||||||||||||||||
Specific Function | May play a role in germ cell development. May play a role in sperm motility. | |||||||||||||||||
Pathways | Not Available | |||||||||||||||||
Reactions |
|
|||||||||||||||||
GO Classification |
|
|||||||||||||||||
Cellular Location | Not Available | |||||||||||||||||
Gene Properties | ||||||||||||||||||
Chromosome Location | 5 | |||||||||||||||||
Locus | 5p15.2-p13.1 | |||||||||||||||||
SNPs | Not Available | |||||||||||||||||
Gene Sequence | Not Available | |||||||||||||||||
Protein Properties | ||||||||||||||||||
Number of Residues | Not Available | |||||||||||||||||
Molecular Weight | 75820.165 | |||||||||||||||||
Theoretical pI | 5.494 | |||||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||||
Signals | Not Available | |||||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||||
Protein Sequence |
>>gi|216548263|ref|NP_001136021.1| probable ATP-dependent RNA helicase DDX4 isoform 2 [Homo sapiens] MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFA SGRNFGNRDA |
|||||||||||||||||
External Links | ||||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||||
UniProtKB/Swiss-Prot ID | Q9NQI0 | |||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||||
PDB IDs | Not Available | |||||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||||
GeneCard ID | Not Available | |||||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||||
HGNC ID | HGNC:18700 | |||||||||||||||||
References | ||||||||||||||||||
General References | Not Available |