Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11683
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX52
Synonyms
  1. ATP-dependent RNA helicase ROK1-like
  2. DEAD box protein 52
Gene Name DDX52
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Cellular Component
nucleolus
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 67497.55
Theoretical pI 9.67
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|38569505|ref|NP_008941.2| probable ATP-dependent RNA helicase DDX52 [Homo sapiens]
MDVHDLFRRLGAGAKFDTRRFSADAARFQIGKRKYDFDSSEVLQGLDFFGNKKSVPGVCG
ASQTHQKPQN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y2R4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20038
References
General References Not Available