You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Probable ATP-dependent RNA helicase DDX53 (HMDBP11684)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11684 | ||||||
Secondary Accession Numbers | None | ||||||
Name | Probable ATP-dependent RNA helicase DDX53 | ||||||
Synonyms |
|
||||||
Gene Name | DDX53 | ||||||
Protein Type | Unknown | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Not Available | ||||||
Pathways | Not Available | ||||||
Reactions |
|
||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | X | ||||||
Locus | Xp22.11 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 71153.72 | ||||||
Theoretical pI | 9.071 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>>gi|55749865|ref|NP_874358.2| DEAD box protein 53 [Homo sapiens] MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMV GVVIGYSGSK |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q86TM3 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | |||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:20083 | ||||||
References | |||||||
General References | Not Available |