You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11684
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX53
Synonyms
  1. Cancer-associated gene protein
  2. Cancer/testis antigen 26
  3. DEAD box protein 53
  4. DEAD box protein CAGE
  5. CT26
Gene Name DDX53
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Cellular Component
nucleus
Molecular Function
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xp22.11
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 71153.72
Theoretical pI 9.071
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|55749865|ref|NP_874358.2| DEAD box protein 53 [Homo sapiens]
MSHWAPEWKRAEANPRDLGASWDVRGSRGSGWSGPFGHQGPRAAGSREPPLCFKIKNNMV
GVVIGYSGSK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86TM3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20083
References
General References Not Available