You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11688
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX58
Synonyms
  1. DEAD box protein 58
  2. RIG-I-like receptor 1
  3. Retinoic acid-inducible gene 1 protein
  4. Retinoic acid-inducible gene I protein
  5. RLR-1
  6. RIG-1
  7. RIG-I
Gene Name DDX58
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include: 5'-triphosphorylated ssRNA and dsRNA and short dsRNA (<1 kb in length). In addition to the 5'-triphosphate moiety, blunt-end base pairing at the 5'-end of the RNA is very essential. Overhangs at the non-triphosphorylated end of the dsRNA RNA have no major impact on its activity. A 3'overhang at the 5'triphosphate end decreases and any 5'overhang at the 5' triphosphate end abolishes its activity. Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Detects both positive and negative strand RNA viruses including members of the families Paramyxoviridae: Human respiratory syncytial virus and measles virus (MeV), Rhabdoviridae: vesicular stomatitis virus (VSV), Orthomyxoviridae: influenza A and B virus, Flaviviridae: Japanese encephalitis virus (JEV), hepatitis C virus (HCV), dengue virus (DENV) and west Nile virus (WNV). It also detects rotavirus and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome such as Epstein-Barr virus (EBV). Detects dsRNA produced from non-self dsDNA by RNA polymerase III, such as Epstein-Barr virus-encoded RNAs (EBERs). May play important roles in granulocyte production and differentiation, bacterial phagocytosis and in the regulation of cell migration.
Pathways
  • Cytosolic DNA-sensing pathway
  • Epstein-Barr virus infection
  • Hepatitis B
  • Hepatitis C
  • Herpes simplex infection
  • Influenza A
  • Measles
  • NF-kappa B signaling pathway
  • RIG-I-like receptor signaling pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
response to exogenous dsRNA
positive regulation of interferon-beta production
detection of virus
negative regulation of type I interferon production
positive regulation of interferon-alpha production
positive regulation of sequence-specific DNA binding transcription factor activity
positive regulation of transcription factor import into nucleus
regulation of cell migration
regulation of type III interferon production
RIG-I signaling pathway
innate immune response
virus-host interaction
positive regulation of defense response to virus by host
positive regulation of transcription from RNA polymerase II promoter
Cellular Component
cytosol
actin cytoskeleton
ruffle membrane
tight junction
Molecular Function
metal ion binding
double-stranded RNA binding
ATP binding
double-stranded DNA binding
single-stranded RNA binding
ATP-dependent helicase activity
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9p12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 106598.72
Theoretical pI 6.407
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|27881482|ref|NP_055129.2| probable ATP-dependent RNA helicase DDX58 [Homo sapiens]
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKF
LLELQEEGWF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95786
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:19102
References
General References Not Available