Hmdb loader
Identification
HMDB Protein ID HMDBP11691
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX60
Synonyms
  1. DEAD box protein 60
Gene Name DDX60
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Positively regulates DDX58/RIG-I- and IFIH1/MDA5-dependent type I interferon and interferon inducible gene expression in response to viral infection. Binds ssRNA, dsRNA and dsDNA and can promote the binding of DDX58/RIG-I to dsRNA. Exhibits antiviral activity against hepatitis C virus and vesicular stomatitis virus (VSV).
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
response to virus
defense response to virus
innate immune response
positive regulation of MDA-5 signaling pathway
positive regulation of RIG-I signaling pathway
Cellular Component
cytoplasm
Molecular Function
double-stranded RNA binding
ATP binding
double-stranded DNA binding
single-stranded RNA binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q32.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 197851.375
Theoretical pI 7.599
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|222831595|ref|NP_060101.3| probable ATP-dependent RNA helicase DDX60 [Homo sapiens]
MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQ
NLHFFYLVER
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IY21
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25942
References
General References Not Available