Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11693
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DDX6
Synonyms
  1. ATP-dependent RNA helicase p54
  2. DEAD box protein 6
  3. Oncogene RCK
Gene Name DDX6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function In the process of mRNA degradation, may play a role in mRNA decapping.
Pathways
  • RNA degradation
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay
gene expression
cytoplasmic mRNA processing body assembly
Cellular Component
cytosol
cytoplasmic mRNA processing body
RNA-induced silencing complex
cytoplasmic stress granule
Molecular Function
RNA helicase activity
ATP binding
ATP-dependent helicase activity
RNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q23.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 54416.42
Theoretical pI 8.666
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|380692342|ref|NP_001244120.1| probable ATP-dependent RNA helicase DDX6 [Homo sapiens]
MSTARTENPVIMGLSSQNGQLRGPVKPTGGPGGGGTQTQQQMNQLKNTNTINNGTQQQAQ
SMTTTIKPGD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P26196
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2747
References
General References Not Available