Showing Protein Putative ATP-dependent RNA helicase DHX30 (HMDBP11696)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11696 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Putative ATP-dependent RNA helicase DHX30 | |||||||
Synonyms |
|
|||||||
Gene Name | DHX30 | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Required for optimal function of the zinc-finger antiviral protein ZC3HAV1 (By similarity). Associates with mitochondrial DNA. | |||||||
Pathways | Not Available | |||||||
Reactions |
|
|||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 3 | |||||||
Locus | 3p21.31 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 129436.68 | |||||||
Theoretical pI | 8.529 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|20336290|ref|NP_055781.2| putative ATP-dependent RNA helicase DHX30 isoform 2 [Homo sapiens] MAASRDLLKEFPQPKNLLNSVIGRALGISHAKDKLVYVHTNGPKKKKVTLHIKWPKSVEV EGYGSKKIDA |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | Q7L2E3 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | ||||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:16716 | |||||||
References | ||||||||
General References | Not Available |