Showing Protein Probable ATP-dependent RNA helicase DHX35 (HMDBP11700)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11700 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Probable ATP-dependent RNA helicase DHX35 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | DHX35 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | May be involved in pre-mRNA splicing. | ||||||||
| Pathways | Not Available | ||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 20 | ||||||||
| Locus | 20q11.22-q12 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 78909.65 | ||||||||
| Theoretical pI | 8.588 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|20544129|ref|NP_068750.2| probable ATP-dependent RNA helicase DHX35 isoform 1 [Homo sapiens] MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQRQKLPVFKLR NHILYLIENY |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q9H5Z1 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:15861 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||