Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11701
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DHX36
Synonyms
  1. DEAH box protein 36
  2. MLE-like protein 1
  3. RNA helicase associated with AU-rich element ARE
Gene Name DHX36
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Plays a role in degradation and deadenylation of mRNAs containing in their 3'-UTR the consensus ARE sequence element. May function in sex development and spermatogenesis.
Pathways
  • RNA degradation
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
response to exogenous dsRNA
response to virus
Cellular Component
cytoplasm
nucleus
Molecular Function
double-stranded RNA binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q25.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 113152.305
Theoretical pI 7.667
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|167830436|ref|NP_001107869.1| probable ATP-dependent RNA helicase DHX36 isoform 2 [Homo sapiens]
MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGR
EIGMWYAKKQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H2U1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:14410
References
General References Not Available