Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11705
Secondary Accession Numbers None
Name Probable ATP-dependent RNA helicase DHX58
Synonyms
  1. Probable ATP-dependent helicase LGP2
  2. Protein D11Lgp2 homolog
  3. RIG-I-like receptor 3
  4. RIG-I-like receptor LGP2
  5. RLR-3
  6. RLR
Gene Name DHX58
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a regulator of DDX58/RIG-I and IFIH1/MDA5 mediated antiviral signaling. Cannot initiate antiviral signaling as it lacks the CARD domain required for activating MAVS/IPS1-dependent signaling events. Can have both negative and positive regulatory functions related to DDX58/RIG-I and IFIH1/MDA5 signaling and this role in regulating signaling may be complex and could probably depend on characteristics of the infecting virus or target cells, or both. Its inhibitory action on DDX58/RIG-I signaling may involve the following mechanisms: competition with DDX58/RIG-I for binding to the viral RNA, binding to DDX58/RIG-I and inhibiting its dimerization and interaction with MAVS/IPS1, competing with IKBKE in its binding to MAVS/IPS1 thereby inhibiting activation of interferon regulatory factor 3 (IRF3). Its positive regulatory role may involve unwinding or stripping nucleoproteins of viral RNA thereby facilitating their recognition by DDX58/RIG-I and IFIH1/MDA5. Involved in the innate immune response to various RNA viruses and some DNA viruses such as poxviruses, and also to the bacterial pathogen Listeria monocytogenes. Can bind both ssRNA and dsRNA, with a higher affinity for dsRNA. Shows a preference to 5'-triphosphorylated RNA, although it can recognize RNA lacking a 5'-triphosphate.
Pathways
  • RIG-I-like receptor signaling pathway
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
response to virus
negative regulation of type I interferon production
defense response to virus
innate immune response
positive regulation of MDA-5 signaling pathway
virus-host interaction
positive regulation of RIG-I signaling pathway
negative regulation of innate immune response
negative regulation of MDA-5 signaling pathway
negative regulation of RIG-I signaling pathway
positive regulation of type I interferon production
Cellular Component
cytoplasm
Molecular Function
metal ion binding
double-stranded RNA binding
ATP binding
single-stranded RNA binding
zinc ion binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q21.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 76612.365
Theoretical pI 7.371
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|149408122|ref|NP_077024.2| probable ATP-dependent RNA helicase DHX58 [Homo sapiens]
MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKVVVLVNRVHLV
TQHGEEFRRM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96C10
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29517
References
General References Not Available