You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein ATP-dependent RNA helicase DHX8 (HMDBP11706)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11706 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | ATP-dependent RNA helicase DHX8 | ||||||||
Synonyms |
|
||||||||
Gene Name | DHX8 | ||||||||
Protein Type | Unknown | ||||||||
Biological Properties | |||||||||
General Function | Not Available | ||||||||
Specific Function | Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome. | ||||||||
Pathways |
|
||||||||
Reactions |
|
||||||||
GO Classification |
|
||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 17 | ||||||||
Locus | 17q21.31 | ||||||||
SNPs | Not Available | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | Not Available | ||||||||
Molecular Weight | 139313.305 | ||||||||
Theoretical pI | 8.328 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals | Not Available | ||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>>gi|4826690|ref|NP_004932.1| ATP-dependent RNA helicase DHX8 [Homo sapiens] MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN TTFDTFKASL |
||||||||
External Links | |||||||||
GenBank ID Protein | Not Available | ||||||||
UniProtKB/Swiss-Prot ID | Q14562 | ||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
PDB IDs | |||||||||
GenBank Gene ID | Not Available | ||||||||
GeneCard ID | Not Available | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | HGNC:2749 | ||||||||
References | |||||||||
General References | Not Available |