Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11710
Secondary Accession Numbers None
Name DNA replication ATP-dependent helicase/nuclease DNA2
Synonyms
  1. hDNA2
  2. DNA replication ATP-dependent helicase-like homolog
Gene Name DNA2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Key enzyme involved in DNA replication and DNA repair in nucleus and mitochondrion. Involved in Okazaki fragments processing by cleaving long flaps that escape FEN1: flaps that are longer than 27 nucleotides are coated by replication protein A complex (RPA), leading to recruit DNA2 which cleaves the flap until it is too short to bind RPA and becomes a substrate for FEN1. Also involved in 5'-end resection of DNA during double-strand break (DSB) repair: recruited by BLM and mediates the cleavage of 5'-ssDNA, while the 3'-ssDNA cleavage is prevented by the presence of RPA. Also involved in DNA replication checkpoint independently of Okazaki fragments processing. Possesses different enzymatic activities, such as single-stranded DNA (ssDNA)-dependent ATPase, 5'-3' helicase and endonuclease activities. While the ATPase and endonuclease activities are well-defined and play a key role in Okazaki fragments processing and DSB repair, the 5'-3' DNA helicase activity is subject to debate. According to various reports, the helicase activity is weak and its function remains largely unclear. Helicase activity may promote the motion of DNA2 on the flap, helping the nuclease function.
Pathways
  • DNA replication
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
DNA replication checkpoint
DNA replication, removal of RNA primer
mitochondrial DNA repair
mitochondrial DNA replication
positive regulation of DNA replication
telomere maintenance via recombination
telomere maintenance via semi-conservative replication
S phase of mitotic cell cycle
DNA double-strand break processing
base-excision repair
Cellular Component
nucleoplasm
mitochondrial nucleoid
Molecular Function
5'-3' DNA helicase activity
5'-flap endonuclease activity
single-stranded DNA-dependent ATPase activity
site-specific endodeoxyribonuclease activity, specific for altered base
metal ion binding
ATP binding
4 iron, 4 sulfur cluster binding
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q21.3-q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 120413.595
Theoretical pI 7.739
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|320461728|ref|NP_001073918.2| DNA replication ATP-dependent helicase/nuclease DNA2 [Homo sapiens]
MEQLNELELLMEKSFWEEAELPAELFQKKVVASFPRTVLSTGMDNRYLVLAVNTVQNKEG
NCEKRLVITA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P51530
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:2939
References
General References Not Available