You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11711
Secondary Accession Numbers None
Name 2'-deoxynucleoside 5'-phosphate N-hydrolase 1
Synonyms
  1. c-Myc-responsive protein Rcl
Gene Name DNPH1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases (By similarity).
Pathways Not Available
Reactions
A deoxyribonucleoside 5'-monophosphate + H(2)0 → Deoxyribose 5-monophosphate + a purine or pyrimidine base details
GO Classification
Biological Process
nucleotide metabolic process
cell proliferation
deoxyribonucleoside monophosphate catabolic process
positive regulation of cell growth
Cellular Component
cytoplasm
nucleus
Molecular Function
deoxyribonucleoside 5'-monophosphate N-glycosidase activity
nucleoside deoxyribosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 19108.255
Theoretical pI 5.037
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|5454002|ref|NP_006434.1| 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 isoform 1 [Homo sapiens]
MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA
ELGARGEEAA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O43598
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:21218
References
General References Not Available