Showing Protein 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 (HMDBP11711)
Identification | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11711 | |||||||||||
Secondary Accession Numbers | None | |||||||||||
Name | 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 | |||||||||||
Synonyms |
|
|||||||||||
Gene Name | DNPH1 | |||||||||||
Protein Type | Unknown | |||||||||||
Biological Properties | ||||||||||||
General Function | Not Available | |||||||||||
Specific Function | Catalyzes the cleavage of the N-glycosidic bond of deoxyribonucleoside 5'-monophosphates to yield deoxyribose 5-phosphate and a purine or pyrimidine base. Deoxyribonucleoside 5'-monophosphates containing purine bases are preferred to those containing pyrimidine bases (By similarity). | |||||||||||
Pathways | Not Available | |||||||||||
Reactions |
|
|||||||||||
GO Classification |
|
|||||||||||
Cellular Location | Not Available | |||||||||||
Gene Properties | ||||||||||||
Chromosome Location | 6 | |||||||||||
Locus | 6p21.1 | |||||||||||
SNPs | Not Available | |||||||||||
Gene Sequence | Not Available | |||||||||||
Protein Properties | ||||||||||||
Number of Residues | Not Available | |||||||||||
Molecular Weight | 19108.255 | |||||||||||
Theoretical pI | 5.037 | |||||||||||
Pfam Domain Function |
|
|||||||||||
Signals | Not Available | |||||||||||
Transmembrane Regions | Not Available | |||||||||||
Protein Sequence |
>>gi|5454002|ref|NP_006434.1| 2'-deoxynucleoside 5'-phosphate N-hydrolase 1 isoform 1 [Homo sapiens] MAAAMVPGRSESWERGEPGRPALYFCGSIRGGREDRTLYERIVSRLRRFGTVLTEHVAAA ELGARGEEAA |
|||||||||||
External Links | ||||||||||||
GenBank ID Protein | Not Available | |||||||||||
UniProtKB/Swiss-Prot ID | O43598 | |||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
PDB IDs | Not Available | |||||||||||
GenBank Gene ID | Not Available | |||||||||||
GeneCard ID | Not Available | |||||||||||
GenAtlas ID | Not Available | |||||||||||
HGNC ID | HGNC:21218 | |||||||||||
References | ||||||||||||
General References | Not Available |